KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00522
Entry
FVIR_GE00522      CDS       T04502                                 

Gene name
pgsA
Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged00564  Glycerophospholipid metabolism
ged01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FVIR_GE00522 (pgsA)
Enzymes [BR:ged01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     FVIR_GE00522 (pgsA)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-ProteinID: CUX96357
UniProt: A0A143WS57
Position
I:928952..929500
AA seq 182 aa
MQLNIPIWLTMFRVVMIPFFVLTFYLPFKWAPVSCALIFILASITDWFDGFLARRWKQTT
RFGAFLDPVADKLIVAIALVLVTEHFHSWWITLTTATMIAREIIISALREWMAEIGKRNN
ITVSWIGKVKTTSQMLALVALLWRPDEIVSGAGIAALYIAALLTFWSMFQYLYAAWRDLF
KY
NT seq 549 nt   +upstreamnt  +downstreamnt
atgcaactaaatataccgatttggcttacaatgtttcgtgttgtaatgataccattcttt
gttctgacattttatctaccttttaaatgggcgcctgtatcttgtgcattgatttttatc
ttggcgtcaataacagattggtttgatggttttctagctcgtcgttggaaacaaactact
cgattcggtgcatttttagatcctgttgctgataaattgatagttgctatagctctagta
ctagtaacagagcattttcattcatggtggattacgttaacaacggcaacaatgattgct
cgcgagattattatttccgctttacgcgaatggatggcagaaataggaaaacgtaataat
ataacagtttcctggattggtaaagtcaaaactacttctcaaatgcttgcattagtagca
ctactatggcgacctgacgaaatcgtctcaggagcaggcattgctgcactatatatagcg
gcactattgacattttggtctatgtttcagtatttatatgctgcctggcgcgatttattt
aaatattaa

DBGET integrated database retrieval system