KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00526
Entry
FVIR_GE00526      CDS       T04502                                 

Gene name
smpB
Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    FVIR_GE00526 (smpB)
SSDB
Motif
Pfam: SmpB
Other DBs
NCBI-ProteinID: CUX96358
UniProt: A0A143WRK9
Position
I:complement(930989..931471)
AA seq 160 aa
MIEKKIRKADYTAIAQNKHAKYEYFIKKEFEAGVSLQGWEVKTLRAGKVNISNSYITLKN
GEAYLFGATFQPLMTAPSYIIYEPMRTRKLLLNKRELDSLFDYVNREGYTVVPLLLYWKK
SWVKIKICVAKGKKRFDKRVNIKEREWLLNKARIIKHISQ
NT seq 483 nt   +upstreamnt  +downstreamnt
atgatagaaaaaaaaataagaaaagctgattatactgctattgcacaaaataaacacgct
aaatatgaatattttataaaaaaagaatttgaagcaggcgtttccttacaaggatgggaa
gtaaaaacgctacgtgctggtaaagtaaatattagcaacagttatataacgctcaagaat
ggagaagcttatctttttggtgctacttttcagccattgatgacagctccctcatatatt
atctatgaacctatgcgaactcgcaaacttttgcttaataaacgtgaactagattcgcta
tttgattatgtaaatcgcgaaggttatactgttgtaccacttttgctttactggaaaaaa
tcgtgggtaaaaataaaaatctgtgtagcaaaaggtaaaaaaagatttgataagcgagta
aatattaaagaacgcgaatggcttttaaataaagcgcgtattataaaacatattagtcaa
tag

DBGET integrated database retrieval system