KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00527
Entry
FVIR_GE00527      CDS       T04502                                 

Gene name
grpE
Definition
(GenBank) Protein GrpE
  KO
K03687  molecular chaperone GrpE
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ged03110]
    FVIR_GE00527 (grpE)
   03029 Mitochondrial biogenesis [BR:ged03029]
    FVIR_GE00527 (grpE)
Chaperones and folding catalysts [BR:ged03110]
 Heat shock proteins
  HSP24
   FVIR_GE00527 (grpE)
Mitochondrial biogenesis [BR:ged03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    FVIR_GE00527 (grpE)
SSDB
Motif
Pfam: GrpE Baculo_PEP_C PKcGMP_CC DMSP_lyase Ribosomal_S2 Piezo_RRas_bdg
Other DBs
NCBI-ProteinID: CUX96359
UniProt: A0A143WU26
Position
I:933166..933756
AA seq 196 aa
MSSKEQNTSFEKVSQENIDMEQEQQTQEEPEVVSTVDPRDERIAELEATLAKIQQIERDS
VLRAKAEMENVRRRSEQEVEKAHKFALERFTSELLPVIDNLERALDMSDKENTELASMIE
GIELTLKSLLNAVRKFGLDVVEHTNVPFNPELHQAMTMLESEEHKPNQVIMVIQKGYTLN
GRLIRPAMVAVSKAKS
NT seq 591 nt   +upstreamnt  +downstreamnt
atgagcagtaaagaacagaatacctcttttgaaaaggtctctcaagagaatatagatatg
gagcaagagcaacagacacaagaggaacctgaagtagttagcactgtggatcctcgagat
gagcgtattgctgaattagaagcaacgttggctaaaatacagcagattgaacgagatagt
gtccttcgtgccaaagcagaaatggaaaatgtacggcgtagaagtgaacaggaggttgag
aaggctcataaatttgctctggagcgttttactagtgagttattaccagtaatcgataat
ttagaacgtgcgttagatatgtcagataaagaaaatactgagctggcatctatgattgaa
ggaatagaactaacactcaaatcattgctaaatgcagtacgtaagtttggtctagatgta
gtagaacatacgaacgtgccatttaatcctgagctgcatcaggcaatgacaatgttggaa
tcggaagaacataaacctaatcaggtaataatggtaattcaaaaaggttatactcttaat
ggtcgacttattcgaccagcaatggttgcagtatcaaaagctaaaagctaa

DBGET integrated database retrieval system