KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00528
Entry
FVIR_GE00528      CDS       T04502                                 

Gene name
ung
Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ged00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    FVIR_GE00528 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ged03400]
    FVIR_GE00528 (ung)
Enzymes [BR:ged01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     FVIR_GE00528 (ung)
DNA repair and recombination proteins [BR:ged03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     FVIR_GE00528 (ung)
 Prokaryotic type
     FVIR_GE00528 (ung)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: CUX96360
UniProt: A0A143WRM7
Position
I:complement(933991..934674)
AA seq 227 aa
MTKILTWQDTLANEKTLPYFRKILAFIKKERQSGTTIYPPDKDIFNAFRFTKLNEVKVVI
LGQDPYHGHNQAHGLSFSVNPGVPIPPSLLNIYKELANDIPGFVIPNHGYLKSWTQQGVM
LLNTILTVEAGKAHSHANLGWEIFTDKVINVLNLQCKGIIFLLWCSHAHKKSRIINLKHH
YVLKAPHPSPLSAHRGFIGCRHFSRANALLEQQGQCPIDWSLTLQVP
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaccaaaatacttacttggcaagatactcttgcaaatgaaaaaactctaccttatttt
cgaaaaatattagcgtttatcaaaaaagagcgacagtctggaacaactatttatcctcca
gataaagatatatttaatgcttttcgttttacaaaactaaatgaagtaaaggtagtgatt
cttggtcaagatccgtatcatggacacaaccaagctcatggtctttctttttcagtcaac
ccgggtgttccaattccaccatctctactaaatatttataaagaactagctaatgatatt
cctggctttgttatcccaaatcatggttatctcaaaagttggacacaacaaggtgtaatg
ttacttaacacgatactaacagtagaagcgggaaaagcacattcccatgccaatctaggc
tgggaaatttttactgataaggttatcaatgtcctaaatttacagtgtaaaggcattatc
tttctactctggtgttctcatgcccataaaaaaagtagaatcatcaatcttaagcatcac
tatgtacttaaagcaccgcatccttcacctctgtctgcccatcgtggctttattggttgt
cgccatttctccagagctaatgcattattagaacaacaaggtcaatgtcctattgattgg
tcattgacattacaggtaccataa

DBGET integrated database retrieval system