KEGG   Geminocystis sp. NIES-3708: GM3708_2257Help
Entry
GM3708_2257       CDS       T04168                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00620  Pyruvate metabolism
gee01200  Carbon metabolism
gee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GM3708_2257
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GM3708_2257
Enzymes [BR:gee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     GM3708_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ACT_4 ACT ELFV_dehydrog AlaDh_PNT_C Shikimate_DH Pyr_redox_3 ThiF
Motif
Other DBs
NCBI-ProteinID: BAQ61851
UniProt: A0A0D6AGB1
Position
2470163..2471554
Genome map
AA seq 463 aa AA seqDB search
MADLTPNSSFSLTVRLELLNRAGTLAKVTKAIAEVGGNLGQVSLIERNLKTIKRELTIDA
FSTEHAEKIVAAIKSVAEVNVLHVSDRTFDIHRGGKIHIQSRIQITSSSDLAMAYTPGVG
RICKAIHEDPENVYSLTIKSNSVAIVTDGSAVLGLGNLGPEAALPVMEGKSMLFKEFADI
DAFPVCLATQDVEEIIKTVKNIAPVFGGVNLEDIAAPRCFEIEKRLQEELKIPIFHDDQH
GTAIVTVAALINALKLVKKEMETIRVVINGAGAAGIAIARLLNKANCTHIIICDSKGIIS
KDRENLTSEKQFFAVEKGGLLKDALVEADVFIGVSAPKILTPEMVKMMAKNPIVFAMANP
IPEIQPELIQDIAAVVATGRSDYPNQINNVLAFPGLFRGALDCRATALTTEMYLQAAKAI
ASLVSPNVLDKEHIIPSVFDNRVATTVSAAVQQAAREAGVAKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttaacccctaattctagttttagtttaacagtccgcttagaattattaaac
cgagcaggtacattagcaaaagttaccaaagctatcgccgaagttggtggtaatttggga
caagtttccctcattgagcggaatttgaaaactatcaaacgagaattgactattgatgct
ttcagcacagaacacgcagaaaaaattgtcgctgcaattaaatctgttgctgaagttaat
gttcttcatgtaagcgatcgcacttttgatattcaccgaggaggaaaaattcatattcaa
agtcgtatccagataacctcttcctctgacttagcaatggcttatactcccggtgttggt
agaatttgtaaagctattcatgaagatcccgaaaatgtatattctttgacaattaaaagt
aatagtgtagcaattgttactgatggtagtgccgtattgggattaggaaatttaggccca
gaagcggcattacctgtcatggaaggaaaatctatgttatttaaagaatttgctgacata
gatgcttttcccgtctgtttagcaactcaggatgtcgaagaaattattaaaaccgttaaa
aatattgcccctgtttttggtggggttaacctcgaagatattgccgcacctcgttgcttt
gaaatcgaaaaaagattacaggaagaattaaaaattcctatttttcatgatgatcaacat
ggtactgcgattgtcaccgtagcggcattaatcaatgctttgaaacttgtcaaaaaagaa
atggaaaccattcgggtggttattaatggtgctggtgcggcaggtattgccatcgctcgt
ttattgaataaagctaattgtactcatataattatttgtgactctaaaggtattataagt
aaagatcgggaaaatttaacctcagaaaagcaattttttgcggtagaaaaaggtggttta
ctaaaagatgctttagtggaggcggatgtctttatcggagttagtgcccccaaaattcta
actccagaaatggtaaaaatgatggcaaaaaacccgattgtttttgctatggctaaccct
atccctgaaattcaaccggaattaatccaagatattgcggctgttgttgctactggtaga
agtgattatcctaatcaaattaataacgtgttggcttttccgggtttatttcgaggtgct
ttagattgtcgtgctactgccttaacaacggagatgtatcttcaagccgcaaaagccatc
gcctctttagtttctcctaatgtattagataaagaacatattattccttctgtgtttgat
aatcgagttgctactacagtatctgccgcagtgcaacaagccgcccgagaagcaggtgtt
gctaaattataa

DBGET integrated database retrieval system