KEGG   Geminocystis sp. NIES-3708: GM3708_2401Help
Entry
GM3708_2401       CDS       T04168                                 

Definition
(GenBank) photosystem II protein D1 PsbA
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00195  Photosynthesis
gee01100  Metabolic pathways
Module
gee_M00161  Photosystem II
gee_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    GM3708_2401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gee00194]
    GM3708_2401
Enzymes [BR:gee01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     GM3708_2401
Photosynthesis proteins [BR:gee00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    GM3708_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: BAQ61995
UniProt: A0A0D6AGE3
Position
2637311..2638378
Genome map
AA seq 355 aa AA seqDB search
MTTTLQQQQSSAWEQFCQWITSTNNRLYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDID
GIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLI
GIFCYMGRQWELSFRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTFN
FMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFGQ
EEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVIGIWFTAMGVSTMAFNLNGFN
FNQSILDSQGHVIGTWADVLNRANIGIEVMHERNAHNFPLDLASAEPVSAPVING
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgactaccactttacagcaacaacagtcttccgcatgggagcagttttgtcagtggatc
acttctaccaacaaccgcttatatgtaggttggttcggtactttaatgatccctaccctc
ttaactgcaactacctgttttatcatcgcatttatcgcagctcctcccgttgacattgac
ggtattcgtgagcctgtagctggatccttactctatggaaacaacatcatctctggtgcg
gttgttccttctagtaatgccatcggtcttcacttctaccctatttgggaagcagcatct
ttagatgaatggttatataacggtggtccttaccagttagtagtattccacttcttgatc
ggtatcttttgttatatgggtcgtcagtgggaactatctttccgtttaggaatgcgtcct
tggatctgtgttgcttattctgcacctgtatctgctgctactgctgtattcttaatctac
cccatcggtcaaggttctttctctgatggtatgcctttaggaatctctggaacatttaac
ttcatgtttgtattccaagctgagcacaacattttaatgcaccccttccatatgttagga
gtggcaggtgttttcggtggatctttattctccgcgatgcacggttctttagtaacttct
tccttagtgcgtgaaaccactgaaactgaatctcaaaactacggttacaagttcggtcaa
gaagaagaaacctacaatatcgtagcggcacatggatactttggtcgtttaatcttccaa
tatgcatccttcaacaacagtcgtgcgttacacttcttcttaggtgcatggcctgtaatt
ggtatttggttcaccgcaatgggtgtaagtaccatggcatttaacctcaacggtttcaat
ttcaaccagtctatcttagatagtcaaggtcatgtaattggaacttgggcagatgtgtta
aaccgtgcaaacatcggtatcgaagtaatgcacgagcgtaacgctcacaacttcccctta
gatttagcaagtgcagagcctgtatctgctcctgtaatcaacggttaa

DBGET integrated database retrieval system