KEGG   Geminocystis sp. NIES-3708: GM3708_3058Help
Entry
GM3708_3058       CDS       T04168                                 

Definition
(GenBank) light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00860  Porphyrin and chlorophyll metabolism
gee01100  Metabolic pathways
gee01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM3708_3058
Enzymes [BR:gee01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     GM3708_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 RNA_helicase NACHT SRP54 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAQ62652
UniProt: A0A0D6AIM3
Position
3367823..3368695
Genome map
AA seq 290 aa AA seqDB search
MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTL
QEKDFHYEDIWAEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDV
ILFDVLGDVVCGGFAAPLNYADYCLIITDNGFDALFAANRIAASVREKARTHPLKLAGLI
GNRTSKRDLIDKYISHVAMPVLEVLPLIEDIRVSRVKGKTLFEMAEKDPSLDYVCDFYLN
IADQILALPEGVVPSEALDRELFGLLSDYYLNPPADAPKQEKDELELMMV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgactttgacattagcagtttacggaaaaggcggtattggcaaatccaccaccagttgc
aacatttctacagcattggcaaaaagaggtaaaaaagtattacaaattgggtgtgatcca
aaacatgatagcactttcacccttacaggctttttaattcccaccatcattgacacattg
caagaaaaagatttccactatgaagatatttgggcggaagacgttatctataaaggttat
gctggtgttgactgtgtagaggctggtggtcctcctgcgggtgctggttgtggtggttat
gtcgtaggtgaaaccgtaaaactgttaaaagagttaaacgcctttgatgaatatgatgtg
attttatttgacgtattgggtgacgtggtatgcggtggatttgccgcacctctaaattat
gctgattattgtttaatcatcactgacaacggttttgatgctttatttgccgccaatcgt
atcgccgcatctgtcagagaaaaagcgcgcactcatcccttaaaattagctggtttaatt
ggtaatcgcacctcaaaacgtgacttaattgataaatatatttcccatgtagcaatgcct
gtattagaagtattacccctcattgaagacatccgagtatcaagagtcaagggtaaaact
ttgtttgaaatggcagaaaaagatccttctttagattacgtttgtgatttttacttgaat
atagctgatcaaattttagctttacctgaaggagtggtgcctagtgaagcccttgatcgt
gaattatttggattactctccgattactacttaaatcctcctgcggatgcgcctaaacaa
gaaaaagacgaattagagttaatgatggtttaa

DBGET integrated database retrieval system