KEGG   Geminocystis sp. NIES-3708: GM3708_359Help
Entry
GM3708_359        CDS       T04168                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gee00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GM3708_359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gee01007]
    GM3708_359
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gee03016]
    GM3708_359
   03029 Mitochondrial biogenesis [BR:gee03029]
    GM3708_359
Enzymes [BR:gee01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     GM3708_359
Amino acid related enzymes [BR:gee01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   GM3708_359
Transfer RNA biogenesis [BR:gee03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GM3708_359
 Prokaryotic Type
   Other AARSs
    GM3708_359
Mitochondrial biogenesis [BR:gee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GM3708_359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1e tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: BAQ59953
UniProt: A0A0D6AB43
Position
complement(410001..411749)
Genome map
AA seq 582 aa AA seqDB search
MIDKLRNLFTSALIQAFGDELSSIDPLVVPASNPKFGDYQCNVALSLAKTLQQPPRLIAQ
TIINNVKLDNFCEPLEIAGPGFINIKIKPEYIAKKIKLAYQDDYLGITKSDESYNIIVDF
SSPNIAKEMHVGHLRSTIIGDSIARILELRGYNVLRLNHVGDWGTQFGMLINYLRTEKPE
VLTTANAVEIGDLVTLYKQAKIKFDQDLDFQEQARQEVVKLQSKDPESIKAWQLLCEQSR
REFEIIYQLLDIKLTERGESFYNPFLQDIITDLEDANILTEDQGAKCVFLDGFVNKEGNP
LPLIVQKSDGGYNYATTDLAALKYRINEDKARRIIYVTDAGQSNHFAQVFQVAKKANFIP
ENVELVHVPFGLVLAEDGKKIKTRSGETIRLKDLLDEAVNRAKLDLQKRLQTEERNETED
FINQVSKIVGLSAVKYADLSQNRTTDYKFSYDKMLSLQGNTAPYLLYVYVRVQGISRKGN
IDLNNLNSETPIIFTQDSELVLAKHLLQLDFIIKEVEKDLLPNRLCLYLFELSQKFNQFY
DQCPILQAEEKIKLSRLVLADLTAKVIKLGLSLLGISVLERM
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaaacttagaaatctttttacttctgctttaattcaagcctttggcgatgaa
ctttcaagtatagatcctttagtagtacccgctagtaatcctaaatttggcgactatcaa
tgcaacgttgctttatctttagcaaaaaccttacaacaacctccaagattgatcgctcag
actataatcaataatgttaaattagataatttttgtgaacctttagaaattgcaggacct
ggatttattaatataaaaattaaacctgaatatattgctaaaaaaataaaattagcttat
caagatgattatttaggaataacaaaaagtgatgaatcttataatattatagttgatttt
tccagtccaaatattgcgaaagaaatgcacgttggacatttaagatctactattattggt
gatagtattgctcgaatattagaattaagaggttataatgttttaagactaaatcatgtg
ggggattggggtactcaatttgggatgttaattaactatttaagaacagaaaaaccagaa
gttttaactactgcaaatgctgttgaaataggtgatttagttactctttataaacaagca
aaaataaaatttgatcaagatttagattttcaagaacaagcacgtcaagaagtagtaaaa
ttacagagtaaagatcctgaaagtatcaaagcatggcaattattatgtgagcaatctcgt
cgagaatttgaaattatttatcaactattagacataaaattaactgaaagaggagaatct
ttttataatccttttttacaagatattattactgatttagaagatgctaatattttaaca
gaagatcaaggggcaaaatgtgtttttctcgatggttttgtcaataaagaaggtaatcca
ttacccttaattgtacaaaaatctgatggtggatataattatgcaactaccgacttagcc
gctttaaaatatcgtatcaatgaagataaagcacgtcgaataatttatgtaactgatgca
gggcaatctaatcattttgctcaagtttttcaagtagcaaaaaaagctaattttatccct
gaaaatgtagaattagttcatgtaccttttggtttagttttagcagaagatggcaaaaaa
atcaagacaagatctggtgaaactattcgcttaaaagacttattagatgaagctgtcaat
cgagccaaattagacttacaaaaacgtttgcaaactgaagaaagaaatgaaacggaagac
tttattaatcaagtaagtaaaattgtgggtttaagtgctgtaaaatatgcagatttaagc
caaaatcgtaccactgattataaatttagttatgataaaatgttatctttacaaggtaat
actgcaccttatcttttatatgtttatgttagagtgcaaggtattagcagaaaaggtaat
attgatttaaataatctcaattctgaaactcctattatttttacacaagacagtgaatta
gtattagcaaaacatcttttacaattagattttattatcaaagaagtagaaaaagattta
ttacctaatcgtctttgtttatatttatttgaattaagtcaaaaatttaaccaattttat
gatcaatgtcctattttacaagcggaagaaaaaattaaattatctcgtttagttttagct
gatttaacggcaaaagttattaaattaggtttatctttattaggaatttcagtgttagaa
agaatgtaa

DBGET integrated database retrieval system