KEGG   Gemmobacter sp. HYN0069: HYN69_01400Help
Entry
HYN69_01400       CDS       T05407                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HYN69_01400
Enzymes [BR:geh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HYN69_01400
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HYN69_01400
    1.1.1.-  
     HYN69_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AWB47339
UniProt: A0A2S0UHQ5
Position
305852..306919
Genome map
AA seq 355 aa AA seqDB search
MRAVRFHGARDIRVEDVAEPSGKLAPDDVLIAPAVTGICGTDLHEYLAGPIVTPKEPHVY
TGATNPQILGHEFSARVLAVGDAVSHVAAGDRISIQPLLSPRNDYYGKRGLFHLSPVMGC
VGLSWAWGGMGEKAVIKDYNAQPVPDNITDDQAAMIEPAAVALYGVDRGGVTAGSTVLVS
GAGPIGALTVLAAHAAGAALVIVSEPNPNRRRIIAEIAPYAIVVDPRSGDLAQVVADLTE
EGVGVDVALECVGLEASLNACVTAVRRQGRVVQVGLHMKPASIDAMLWALKDITVEATWC
YPTQIWPRIARMIAAGNFPVEKVITARIDAKDVVAKGFEALLDPAGEHLKILVTT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcagtccgttttcacggggcacgggatatccgggtcgaggatgtggcagaacct
tcgggcaagctggcgcccgacgatgtgctgatcgccccggcagtgaccggtatttgcgga
accgatctgcacgaataccttgcaggccctatcgtcacgccgaaagagccgcacgtttat
accggagcgaccaacccgcagattctggggcacgagttttctgcgcgggttctggccgtc
ggtgacgcggtaagccatgtggcggcaggggatcgcatttcgatccagccgctgttgtcg
ccgcgcaacgactattacggcaagcgcgggctgttccatctgtcgcccgtcatgggctgc
gtggggctaagctgggcctggggcggaatgggcgaaaaggcggtgatcaaggattacaac
gcccagccggtgcccgataacatcaccgacgatcaagcggccatgatcgaacccgctgcc
gttgcgctgtatggtgtggaccgtggcggggtgacggcagggtcgaccgtgctggtttcg
ggcgcgggtcccatcggcgcgctgacggttctggcggcgcacgccgcaggggctgcgctg
gtcatcgtgtccgagccgaacccgaaccgtcgccggatcatcgccgaaattgcgccctat
gccatcgtggtcgatccccgaagcggagatttggcgcaagtggttgccgatctgaccgaa
gaaggcgtgggcgtggatgtggcgctggaatgcgtcgggcttgaagcgtcgctgaatgcc
tgcgttacggcggtgcgccgtcaggggcgggtggtgcaggtgggcctgcacatgaagcct
gccagcatcgacgcgatgctgtgggccttgaaggacatcaccgtggaagcgacgtggtgc
tacccgacgcaaatctggccgcgcatcgcgcgcatgatcgctgcggggaatttcccggtc
gagaaggtgatcaccgcacggatcgacgccaaggatgtggtcgccaaggggttcgaggca
ctgctcgatccggcgggcgaacatttgaagattctggtcacgacctga

DBGET integrated database retrieval system