KEGG   Gemmobacter sp. HYN0069: HYN69_02300Help
Entry
HYN69_02300       CDS       T05407                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00040  Pentose and glucuronate interconversions
geh00053  Ascorbate and aldarate metabolism
geh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HYN69_02300
   00053 Ascorbate and aldarate metabolism
    HYN69_02300
Enzymes [BR:geh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     HYN69_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWB47496
UniProt: A0A2S0UI61
Position
473550..475055
Genome map
AA seq 501 aa AA seqDB search
MLTGKHLIAGDWVSGPGRFKSSPAAGEGFEFSSASVAEVDRAVKAAEEAYWSYSALTREE
RAVFLERIADEIEARGADLTATGSAETGLPTARLDGERGRTTGQLRLFASHIRKDDFLDL
RHDAALPDRKPLPRPDIRMMQRPVGPVAVFGASNFPLAFSTAGGDTASALAAGCPVVVKG
HPAHPGTGEIVAQAIDAAIRALGLHPGVFSLVQGVGNDLGAALVQHPLITAVGFTGSLGG
GRALFDLCAQRAVPIPFYGELGSVNPMFVLPAAAAARGAAIAAGWAGSLTMGAGQFCTNP
GLVLVMEGAEGDAFVAAAKDAVAAIGPQVMLTEGIATAYRQGAERIGAAKGVRAVLTSMC
DRRNASPYVFEVSGDDWLADHTLGHEVFGPLGVIVRLRDEAQLFAVARGLEGQLTCTLQM
DEPDTGLARRLMPVLERKAGRILANGFPTGVEVSEAMVHGGPYPASTNFGATSVGTMAIR
RWLRPVAFQNLPEALLPDALR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccggaaaacatcttatcgccggagactgggtttcggggccgggacggttcaag
tcctcgcccgcagcgggcgaggggttcgagttctcgagcgcgtcggtcgccgaggtggac
cgtgcggtgaaggcggcggaagaggcctattggtcctattccgcgctgacgcgggaagag
cgggcggtgtttctggaacgcatcgccgacgagatcgaggcgcggggcgccgatctgacc
gccacgggaagcgccgagacgggcctgcccaccgcgcggctggatggcgagcgcgggcgc
acgacggggcagttgcggctgtttgccagccatatccgcaaggacgatttccttgacctg
cgccatgacgcagcacttcccgaccgtaagccgctgccgcgccccgacatccgcatgatg
cagcggcccgtggggccggtggcggtgttcggcgcgtcgaacttcccgctcgcgttttcg
acggcgggcggcgatacggcgtcggctttggcggcgggttgccctgtggtggtcaagggc
catccggcgcatccgggaaccggcgagatcgtagcgcaagccatcgacgcggcgatcagg
gccttgggcctgcatccgggggtgttctcgctggtgcagggggttggcaacgatctgggg
gcggcgctggtgcagcatccgctgattacggcggtcgggttcaccgggtcgctgggtggc
gggcgggcgctgttcgatctgtgcgcgcagcgtgcggtgccgatcccgttctatggcgag
ttggggtcggtcaacccgatgttcgtgctgcccgccgctgcggcggcgcggggggctgcg
atcgctgccggctgggccggttcgctgaccatgggggcgggacagttctgcaccaatccg
gggttggttctggtgatggagggggccgagggcgatgccttcgtcgctgctgccaaggat
gcggtcgcggccatcggcccgcaggtgatgctgaccgaagggatcgccacggcctaccgc
caaggggccgagcggatcggggctgccaagggggtgcgggccgtgctgaccagcatgtgc
gaccgccgcaacgcctcgccttatgtgttcgaggtgtcgggtgacgattggctggccgac
catacgctgggccatgaggtgttcggccccttgggcgtgatcgtgcggttgcgcgacgag
gcgcaactgttcgcggtggcgcgcgggcttgaggggcagttgacctgcaccttgcagatg
gacgaacccgacacgggccttgcgcggcgactgatgccggttctggagcgcaaggccggg
cgtatccttgccaacggctttccgacgggggtcgaagtgagcgaggcgatggtgcatggc
gggccctatccggcatcgaccaactttggcgcgacaagcgtggggacgatggcgatccgg
cgctggctgcggcctgtcgccttccagaacctgcccgaggcgctgttgcccgacgcgttg
cggtga

DBGET integrated database retrieval system