KEGG   Gemmobacter sp. HYN0069: HYN69_05400Help
Entry
HYN69_05400       CDS       T05407                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00860  Porphyrin and chlorophyll metabolism
geh01100  Metabolic pathways
geh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HYN69_05400
Enzymes [BR:geh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     HYN69_05400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ AAA_26 CopK SRP54 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AWB48025
UniProt: A0A2S0UJP9
Position
complement(1110331..1111233)
Genome map
AA seq 300 aa AA seqDB search
MSPKDEIPDLRGLDGEGSVQVHQDNDTKIEGAKVFSVYGKGGIGKSTTSSNLSAAFSMMG
KRVLQIGCDPKHDSTFTLTGRLQPTVIDILKEVDFHAEELRPEDYVATGFNGVKCVEAGG
PPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRAVIVTAN
DFDSIYAMNRIIAAVQAKSGNYKVRLAGCVANRSRETDEVDRYCARVGFNRLAHMPDIDA
IRRSRLKKKTLFEMDDSEDIVMARAEYMRLAETLWRSVQGTGSTPEPLPDREIFELLGFD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgaaagacgaaatccccgatctgcggggtctggacggcgaagggtcggttcag
gtccatcaggacaatgacaccaagatcgaaggggccaaggtcttttcggtctatggcaag
ggcgggatcggcaaatcgacgaccagctcgaacctgtccgccgccttttccatgatgggc
aagcgcgtgttgcagatcggctgcgatccgaaacatgacagcacctttaccctgaccggc
cgcttgcagcccacggtcatcgacatcctgaaagaggtcgatttccacgccgaggaactg
cgccccgaggattacgtggccaccggcttcaacggcgtgaaatgcgtcgaggcgggcggt
ccgcccgcaggcaccggctgcggcggctatgtcgtgggccagacggtgaaactgctcaag
cagcatcatctgctggaagacaccgacgtggtgatcttcgacgtgctgggtgacgtggtg
tgcggcggctttgcagcccccctgcaacacgccgaccgcgccgtgatcgtcaccgcgaac
gacttcgacagcatctacgcgatgaaccgcatcatcgccgccgtccaagccaaatcgggc
aattacaaggtccgtctggcgggctgcgtggccaaccggagccgcgaaaccgacgaggtt
gaccgctactgcgcccgcgtcggcttcaaccgcctggcccatatgcccgacatcgacgcc
atccgccgctcgcgcctgaagaagaagacgctgttcgagatggacgacagcgaagacatc
gtgatggcccgcgccgaatacatgcgccttgccgaaacgctgtggcgatcggtgcaaggc
acggggtcaacgcccgaaccgctgcccgaccgcgaaatcttcgaactgctgggattcgat
tga

DBGET integrated database retrieval system