KEGG   Gemmobacter sp. HYN0069: HYN69_05635Help
Entry
HYN69_05635       CDS       T05407                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HYN69_05635
Enzymes [BR:geh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     HYN69_05635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: AWB48065
UniProt: A0A2S0UJT9
Position
1161490..1162179
Genome map
AA seq 229 aa AA seqDB search
MKRSRINDIMAAADEMIRHYGFVLPPFAYWTPDEFKAKAAQAGRIIDARMGWDITDFGAE
KFDEMGLFLFTLRNGQLADLKRGGGMCYAEKLLISRQDQLSPTHTHFLKAEDIINRGGAT
LVIELYGSDDKGNFAPDRGGMVRCDGLDVPYTPGMKLKLAPGESVTLMPGDWHAFWGEGG
DVLIGEVSTVNDDLIDNIYVQPIGRFAEIEEDVAPTHLLVSDYDSWLPR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctcgcgcatcaatgacatcatggcggcggcggacgagatgatccgccactac
ggcttcgtgctgccgccctttgcctattggacgccggacgagttcaaggccaaggcagca
caggcggggcggatcatcgatgcccgcatgggctgggacatcaccgatttcggggccgag
aagttcgacgagatggggctgttcctcttcaccctgcgcaatggccaattggctgatctc
aagcgcggcgggggcatgtgctatgccgaaaagctgctgatctcgcggcaggaccaattg
tcgcccacgcacacgcactttctaaaggccgaagatatcatcaaccggggcggggccacg
ctggtgatcgagctttacggatcggacgacaaaggcaatttcgcgccggatcgtggcggc
atggtgcgctgtgacgggctcgatgtgccctatacgccggggatgaagctgaaactcgcg
ccgggcgaaagcgtcacgctgatgcccggcgactggcacgccttttggggcgagggcggc
gatgtgctgatcggcgaggtctcgaccgtgaacgacgacctgatcgacaatatctatgtc
cagcccatcggccgcttcgccgagatcgaggaagacgtggcgccgacgcatctgctcgtc
agcgattacgacagctggctgccccgctga

DBGET integrated database retrieval system