KEGG   Geitlerinema sp. PCC 7407: GEI7407_0906Help
Entry
GEI7407_0906      CDS       T02366                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00010  Glycolysis / Gluconeogenesis
gei00052  Galactose metabolism
gei00500  Starch and sucrose metabolism
gei00520  Amino sugar and nucleotide sugar metabolism
gei00521  Streptomycin biosynthesis
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01120  Microbial metabolism in diverse environments
gei01130  Biosynthesis of antibiotics
gei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEI7407_0906
   00052 Galactose metabolism
    GEI7407_0906
   00500 Starch and sucrose metabolism
    GEI7407_0906
   00520 Amino sugar and nucleotide sugar metabolism
    GEI7407_0906
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GEI7407_0906
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GEI7407_0906
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GEI7407_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFY65404
UniProt: K9S6L4
Position
complement(1082213..1083271)
Genome map
AA seq 352 aa AA seqDB search
MALLLAGDIGGTKTILRLVQSDAGSGDRPFRLVPRYEARYLSGHYRSLVPLVRDFLAAAA
QETGETLHPQRACFAIAGPVVNNTCKLTNLPWDLDGDRLSQELNIDQVTLINDFAAVGYG
VLGLEPSDLHTLQAGEYQANAPIGVIGAGTGLGEGFLIPQEGDYQIYPSEGGHADFAPRS
ELEFQLLRYLLDKHNILRVSVERVVSGQGIVAIYQFLRDRGSANESPDVAQTVRTWEAEA
GQTDKSTDPAAVISLAALAGRDPLSGQAMQLFVQAYGAEAGNLALKLLPYGGLYIAGGIA
AKNLPLLQQGDFLRSLNDKGRISSLIKKVPVHVILNPQVGLIGAALYAARRT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgctattactggcaggcgatattggtggcacaaagacgattttgcggctggtgcag
agtgatgcgggcagcggcgatcgcccctttcggctggtgccacgctacgaagcacgctac
ctcagcggccattatcgaagcttggtcccgctagtgcgagacttcttggcggcagcggcc
caggagacgggcgaaaccctccatcctcagcgagcctgttttgcgatcgctggccctgtg
gtcaacaatacctgcaagctaaccaacttaccttgggatctagatggcgatcgcctcagc
caagagctcaatatcgatcaagtcacgctcatcaatgattttgcagcggtcggctatgga
gtcttgggcctagagccgtcggatctgcatacgctccaggcgggtgagtaccaggccaac
gcacccattggcgtgatcggagcgggaactggcctgggcgaaggctttttgatcccccag
gaaggcgactatcaaatttacccgtccgaaggggggcatgcggactttgcaccccgctca
gagctggagtttcagctgctgaggtacctgctggacaagcacaatattttgcgggtttcg
gtggagcgggtggtctctggccaaggcatcgtggcgatttatcagtttttgcgcgatcgc
ggctcggccaacgagtcgcccgacgtggcccagacagtgcgcacctgggaagcagaagca
ggccaaacggacaaaagcaccgatccagcagcggtgatttctctagcagccttggccgga
cgcgatcccctatctggccaagcgatgcagctgtttgtgcaggcctacggcgctgaggcg
ggcaacctcgccctcaagcttttgccctatggggggctgtacatcgccgggggcatcgcg
gccaaaaatctgccgctgctacagcagggggatttcctgcgatcgctcaatgacaagggc
cgcatcagttctctgatcaagaaagtgccggtccacgtcatcctcaaccctcaagtcggc
ctgatcggagccgcgctctacgcagcccgccggacctag

DBGET integrated database retrieval system