KEGG   Geitlerinema sp. PCC 7407: GEI7407_1251Help
Entry
GEI7407_1251      CDS       T02366                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00900  Terpenoid backbone biosynthesis
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01130  Biosynthesis of antibiotics
Module
gei_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GEI7407_1251
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GEI7407_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFY65745
UniProt: K9S6F6
Position
complement(1498624..1499820)
Genome map
AA seq 398 aa AA seqDB search
MKAITLLGSTGSIGTQTLDIVSEHPDQFRVVGMAAGRNVAMLAQQIRQFRPEIVAIWDKD
KLPELKAAIADLEPQPIVLAGEEGVIEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETLIAGGPVVLPLIEKYGVKLLPADSEHSAIFQCLQGVPQGGLRRIILTASGGAF
RDWPVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDHIDIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPERIATSWEPLDLVKAGDLTFRAP
DHQKYPCMQLAYAAGRAAGSMPAVLNAANEQAVALFLEEKIQFLEIPRLIEAVCDRHQAD
NRQQPTLDDILQADAWARQAVLQACEQLHQGDRIVSLR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaattactctccttggctccacaggctcgatcggcacccaaaccctcgacatt
gtgtccgagcaccccgatcagtttcgggtggtgggaatggccgcagggcgcaacgtcgcg
atgctggcgcaacagattcggcaatttcggcctgaaattgtggcgatttgggacaaagac
aagctgcctgagctaaaagcggcgatcgccgacctcgagccccagcccatcgtgctggcc
ggcgaagaaggcgtgatcgaggtggcccgctacggcgactcggaggccgtggtcacaggg
atcgtcggctgcgctggcttgctgcccacgatcgccgccatcgaggccggcaaagacatt
gccctcgccaacaaggagaccctgattgcgggtggtccggtggttctgccgctgatcgag
aaatacggcgtcaaactgctgcccgcagactcggagcactcggcgattttccagtgcttg
cagggagtcccccagggaggactgcggcggatcatcctgacggcgtccgggggcgctttc
cgggactggcccgtcgagaagctggctgaggtgaccgtcgccgacgccctcaagcacccc
aactggtccatgggccgcaagatcaccgtggattcggccacgctgatgaacaagggcctt
gaggtgatcgaagcccactatttgttcggcatggattacgaccacattgatatcgtgatc
catccccaaagcattattcactcgctgatcgagctgcaagacacgtcggttcttgcccag
ctcggctggcccgacatgcggctgccgctgctctacgccatgtcgtggcctgagcgcatc
gccacgagctgggagccgctagacctagtgaaggcgggagatctgaccttccgggcgccg
gatcaccaaaagtatccctgtatgcagctggcctacgcggcgggtcgggccgcgggctcg
atgccggcggtgctaaacgcggccaatgagcaggcggtcgcgctatttttagaggagaaa
atccagttcctggagattccgcgcctgatcgaggcggtctgcgatcgccaccaggcagac
aaccgccagcagccgaccctggacgatatcttgcaggccgatgcttgggctcgccaagcg
gtgctccaggcctgcgaacagctgcatcaaggcgatcgcattgtttctttgcgctag

DBGET integrated database retrieval system