KEGG   Geitlerinema sp. PCC 7407: GEI7407_2217Help
Entry
GEI7407_2217      CDS       T02366                                 

Definition
(GenBank) carbohydrate ABC transporter membrane protein 2, CUT1 family
  KO
K02026  multiple sugar transport system permease protein
Organism
gei  Geitlerinema sp. PCC 7407
Module
gei_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    GEI7407_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3918
Motif
Other DBs
NCBI-ProteinID: AFY66696
UniProt: K9S9Q8
Position
2733206..2734090
Genome map
AA seq 294 aa AA seqDB search
MTTTHQPTPTQTENPYEKRQRIRNIAIALGVFLTVVISLAPILWQVLTSIKVNADISAVP
NVYIPSRYTLEHYILLFERRPFLRYIFNSAFVAIVSTVLALGLGAPAAYALARMRIPGER
IILGIILIVVLFPYILLFLGLLQVVQALGIGNNYLVLIVPYTAINLPLTILTLRSFFLQL
PKDLEDAAKVDGYSTLGMLLKIVLPMTLPALVTTGILAFIFAWNEYIFALTFVTRESLKT
IPVAAAQLSGATLFSIPYGPLAAATSLGTFPLIILVLIFQRKIVQGLTSGAVKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgactcatcaacccacccctactcaaaccgagaatccctacgaaaagcgccag
cgcattcgcaatatcgcgatcgcccttggcgtgtttttgaccgtggtgatcagccttgcc
cccatcctgtggcaggtgctgacgtcgatcaaggtcaacgcggatatctctgctgtcccc
aatgtctatattcccagtcgctataccctcgagcactatattttgctgtttgagcggcgg
cctttcctgcgctatatcttcaacagcgcttttgtcgccattgtctctacggtgcttgct
ttgggactgggtgctcccgctgcctacgctctggcgcgtatgcggatcccgggagagcgc
atcattttgggaattattttaattgtcgttttgttcccttatattttgctgttcttgggt
ctgctgcaagtggtgcaggccttgggcatcggcaacaactatctggtgctgatcgtgccc
tacaccgccattaacctgcccttgaccattctcaccctgcgcagcttctttcttcagttg
cccaaagatctcgaagatgcagccaaagtggacggctacagcaccctgggcatgctgctg
aaaatcgtgctgcccatgaccctccccgcgctggtcaccacaggcattttggcctttatc
tttgcctggaatgagtatattttcgcgctgaccttcgtgacgcgagagtctctcaaaacg
atccccgttgcagcggcccagctcagcggcgcgacgctattcagcattccctacggtccc
ctggccgccgcgacgtctctgggaacctttccgttgattattctggtgctgatcttccag
cgcaagatcgttcagggtctcacctccggcgcggttaagggatag

DBGET integrated database retrieval system