KEGG   Geitlerinema sp. PCC 7407: GEI7407_2223Help
Entry
GEI7407_2223      CDS       T02366                                 

Definition
(GenBank) sucrose-6F-phosphate phosphohydrolase
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S6PP Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AFY66702
UniProt: K9S7T9
Position
2742887..2743630
Genome map
AA seq 247 aa AA seqDB search
MRSNYSLVLATDLDGTFLGGSSQQRAEFYQSIQACRDDILLVFVTGRDLGFVRSLCEDPL
FPHPDYIIGDVGTTIVDGRTHEPLREVQDWVSDRWQDAGDRVKAMLADEPGLELQPVPTE
RRISYYYKPDELQPSTVQKVIDAGFDCILSADLYLDVMPKGIAKGPTLLKFIDALSLDPD
SVIPCGDTLNDLSLFETGLKSVAVGNSEPKLVKAIQTMDNVYHSPHPGVAGIRDGLTVYG
KQLEVAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccaactactcgctagttcttgccactgatctagacggcacgtttctaggagga
tccagtcagcagcgcgctgaattctaccaatccattcaggcctgccgcgacgatatacta
ctcgtctttgtcaccgggcgcgatctcggtttcgttcgcagcctctgcgaagatcccctt
tttccccatcctgattacatcattggcgacgtgggcaccaccattgtggatgggcgcacc
cacgagcccctgcgcgaagtccaagactgggtgagcgatcgctggcaagacgcaggcgat
cgcgtcaaagccatgctggccgacgagcccggcctcgagctgcagcccgtccccaccgag
cggcgcatctcctactattacaagcctgacgaactgcagcccagcaccgttcaaaaggtg
atcgatgccgggtttgactgcattctctccgccgatttgtaccttgacgtgatgcccaaa
ggcattgctaaaggccccacgctgctgaaatttatcgacgctctcagcctcgatcccgac
agcgtgattccctgcggcgacaccctcaacgatctctctctctttgagaccggcctcaaa
agcgttgcggtcggcaactccgagcccaagctggtcaaagcaattcaaacgatggacaac
gtttatcacagtccccatcccggcgttgcgggcatccgggacggactcacggtctatggc
aaacaactagaggttgctgcatga

DBGET integrated database retrieval system