KEGG   Geitlerinema sp. PCC 7407: GEI7407_2226Help
Entry
GEI7407_2226      CDS       T02366                                 

Definition
(GenBank) NAD-dependent glycerol-3-phosphate dehydrogenase domain protein
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00564  Glycerophospholipid metabolism
gei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GEI7407_2226
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     GEI7407_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N F420_oxidored NAD_binding_8 ApbA 3HCDH_N NAD_binding_2 2-Hacid_dh_C Epimerase Sacchrp_dh_NADP THF_DHG_CYH_C XdhC_C Glyco_trans_4_4 DUF4350 IlvN 2-Hacid_dh Glyco_transf_4 Fox-1_C DUF4129
Motif
Other DBs
NCBI-ProteinID: AFY66705
UniProt: K9S970
Position
2747172..2748179
Genome map
AA seq 335 aa AA seqDB search
MVSNLTQVQSTPKTSFSKGAIAPLNPFPSRTSTATATVLGAGAWGSALATLLRRNGHDVR
VWSRRSNETLEEAIAGVDVIVSAIPMKGVSATVEALQEFTLPANMLVVTATKGLDPNTAE
TPSQIWQQAFPEHPVVVLSGPNLSKEIQQGLPAASVAASTSPQAAEEVQKLFSSDAFRVY
TNDDPLGTELGGTLKNVIAIAAGICDGLELGTNAKAALISRALAEMVRVGLHFGAKAETF
CGLSGLGDLLATCDGPLSRNYRVGQGLATGKSLTQVLEDLKSTAEGVNTTQVLMGIAQEN
QLDLPIARCVYSVIRGKVSPQRAVEGLMGRELTAE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaatctaacccaagtccaatccactcccaaaacttcctttagcaaaggggcg
atcgctcccctcaatccctttccctcccgaacttctacagcaacggccacagtccttggg
gccggagcctggggcagcgccctggctaccctcctgcgccgcaacggccacgatgtccgg
gtatggtcccggcgctcgaacgaaaccctagaagaggcgatcgcgggcgtcgatgtgatc
gtttctgcaattcccatgaagggcgtcagcgccacggtagaggctctccaagagttcacc
ttaccggccaatatgctggtggttacagccaccaagggactagatcccaacaccgccgaa
acgccctcccagatttggcagcaggcctttcccgagcatccggttgtagtgctttccggc
cccaatctctctaaggagattcagcagggtctccccgccgccagcgtggccgccagcacc
agcccccaggccgccgaagaagtgcagaaactcttttcttcggacgcttttcgggtctat
accaatgacgatcccctcggcacagagctcgggggcaccctcaaaaacgtcatcgcgatc
gccgctggcatctgcgacggcctcgagctcggcaccaacgccaaagccgccctgatcagc
cgcgccctcgccgagatggtgcgggtcggtctccactttggcgcgaaagcagagacattt
tgtggcctatcgggcctaggagatttgctggccacctgtgacggccccctcagccgcaac
taccgcgtcggccagggtctggccaccggcaaatctctcacccaggtgctcgaagatctc
aagagcacagctgaaggtgtgaacaccactcaggttctgatgggtatcgcccaggagaac
cagttagatctgccgatcgcccggtgcgtctacagtgtcattcgcgggaaagtctctccc
caaagagctgtagaaggcctaatggggcgagagctgacggctgagtaa

DBGET integrated database retrieval system