KEGG   Geitlerinema sp. PCC 7407: GEI7407_2227Help
Entry
GEI7407_2227      CDS       T02366                                 

Definition
(GenBank) carbohydrate ABC transporter ATP-binding protein, CUT1 family
  KO
K10112  multiple sugar transport system ATP-binding protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei02010  ABC transporters
Module
gei_M00201  alpha-Glucoside transport system
gei_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:gei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GEI7407_2227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gei02000]
    GEI7407_2227
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    GEI7407_2227
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    GEI7407_2227
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    GEI7407_2227
   alpha-Glucoside transporter [MD:M00201] [OT]
    GEI7407_2227
   Glucose/mannose transporter [MD:M00605] [OT]
    GEI7407_2227
   Cellobiose transporter [MD:M00206] [OT]
    GEI7407_2227
   N,N'-Diacetylchitobiose transporter [MD:M00606] [OT]
    GEI7407_2227
   Putative fructooligosaccharide transporter [MD:M00197] [OT]
    GEI7407_2227
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    GEI7407_2227
   Arabinosaccharide transporter [MD:M00602] [OT]
    GEI7407_2227
   Putative multiple sugar transporter [MD:M00207]
    GEI7407_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 TOBE_2 SMC_N AAA_22 Rad17 AAA_16 AAA_29 G-alpha RsgA_GTPase AAA_33 AAA AAA_15 AAA_23
Motif
Other DBs
NCBI-ProteinID: AFY66706
UniProt: K9S9R8
Position
complement(2748358..2749431)
Genome map
AA seq 357 aa AA seqDB search
MAKLEIRNLNKTYNRKTVPVKDISLDVSDNEFLTLLGPSGCGKSTTLRLIAGLEQPTRGQ
VLIGSQDVTNLRPGDRNIAMVFQSYALYPHMSVFENMASSLKLRKTPSDEIHQRIGDATR
VLGLEGLMDRKPSQLSGGQRQRVALGRALVRRPDVFLLDEPLSNLDALLRERVRADIKQL
FESQQVPVVYVTHDQTEAMTLSTKVAVLNQGLVQQLAPPAQIYSDPANQFVAGFVGSPQM
NLLTLPCQGPYAVLGSTKIPLPDNLTPPPEIVLGIRPENLRFPQPGDDLKVEGRVFLVEN
LGMSNLISMEVKGEGQKAEIVRALVPIDQSWSGDHVALALVPSAIYWFDVKSGDRVG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactagaaattcgtaacctcaataaaacttataatcgcaaaacggttccggtc
aaagatatcagtcttgatgttagcgacaatgaatttctgacgcttttggggccttcaggc
tgcggcaaatccacgactctgagactaattgctggtctggaacagccaacgcgaggtcag
gttctgatcggctcccaggatgtcacgaatttgcggccgggcgatcgcaatatcgccatg
gtgtttcagagctatgcgctgtatccacacatgagcgtgtttgagaatatggcctctagc
ctgaagctgcgcaaaactccctcggatgagatccatcagcgaattggagacgcgacgcgg
gtgctcggcctcgaaggcctgatggatcgcaagccgagccagctctccggcgggcagcgt
cagcgggtagccctggggcgggcgcttgtgcgccgtccagatgtctttctgttagatgag
cccctgagtaacctggatgccctgctgcgggagcgggtgcgggctgacatcaagcagctg
tttgagtctcagcaggtgccggtggtctacgtgacccacgaccaaaccgaggccatgacg
ctgtcgacaaaggtagctgtgctgaatcagggactggtgcagcagctcgcgccgccagcc
cagatctactctgatccggccaatcagtttgtggcgggctttgtgggtagtccccagatg
aacttgctgacgctcccctgccagggaccctacgcggtgctgggctccaccaagatccca
ttgcctgataaccttacgccgccgccggagattgtgctggggattcgccccgaaaatctc
cgctttcctcagcccggcgatgatctaaaagtcgaggggcgcgtattcttggtggaaaac
ttggggatgagcaatctcatcagcatggaagtaaaaggagagggtcaaaaagctgagatc
gtgcgggctctggtgccgatcgaccagtcttggagcggagaccacgtagctctggcgctc
gtgccatctgcgatctattggtttgatgtcaaatcgggcgatcgcgtgggctag

DBGET integrated database retrieval system