KEGG   Geitlerinema sp. PCC 7407: GEI7407_2234Help
Entry
GEI7407_2234      CDS       T02366                                 

Definition
(GenBank) transcriptional regulator
  KO
K09012  DeoR family transcriptional regulator, suf operon transcriptional repressor
Organism
gei  Geitlerinema sp. PCC 7407
Brite
KEGG Orthology (KO) [BR:gei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gei03000]
    GEI7407_2234
Transcription factors [BR:gei03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    GEI7407_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_24 HTH_11 HTH_5 MarR_2 HTH_DeoR HTH_20 HTH_34 HTH_29 MarR TrmB PadR GntR TFIIE_alpha HTH_28 HTH_Crp_2 Rrf2 HxlR HTH_12 HTH_AsnC-type Fe_dep_repress HTH_IclR FaeA HTH_10 DUF2250 HTH_23 FeoC HTH_9 AbiEi_4 LexA_DNA_bind SgrR_N Mga B-block_TFIIIC Sigma70_r3 Sigma70_r4 HTH_38 HTH_36
Motif
Other DBs
NCBI-ProteinID: AFY66713
UniProt: K9S930
Position
complement(2755950..2756600)
Genome map
AA seq 216 aa AA seqDB search
MATSQHPSTKQDILQRLLKQGQATAQELAETLEISPQAIRRHLKDLEAEGLIQYQSVQAG
MGRPQHVYQLSRQGRDRFPDRYGEFAMSLLDTLAQTVGQEQVSSILRKQWERKAQEYRDR
LHNGGSVRDRVALLVELRRAEGYMAEWYPADASGDEAEGYVITEYNCAISDIAESFPSVC
GHELEMFSAALPDCAVERTHWLIDGEHRCGYLIRAR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttcgcagcatccttctactaagcaagatatcctccaacgtttgctgaagcag
ggtcaagcgacggcccaggaactggctgagacccttgagattagtcctcaggcgatccgt
cgccacctaaaggatctggaggcggaggggctgatccagtaccagagtgtgcaggcgggg
atgggccgaccgcagcacgtgtatcagctgagtcgccaggggcgcgatcgctttcccgat
cgctacggggagtttgcgatgtcgctgctggacacgctggcgcagacggtgggccaggag
caggtgagcagcattttgcgcaagcagtgggagcgcaaggcccaagaatatcgcgatcgc
ctgcacaatgggggctcggtgcgcgatcgcgtggcgctgctggtggagttgcggcgggcc
gagggctatatggcggagtggtatccggccgatgccagcggcgatgaagcagagggctac
gtcattacagaatacaactgcgcgatttctgatattgcggagtcgtttccgagcgtgtgc
ggccacgagctagagatgtttagcgcggcgctgcctgactgcgcggtggagcgaacgcac
tggctgatcgacggggagcaccgctgcggctatttgatccgggcgcgctaa

DBGET integrated database retrieval system