KEGG   Geitlerinema sp. PCC 7407: GEI7407_2241Help
Entry
GEI7407_2241      CDS       T02366                                 

Definition
(GenBank) photosystem I iron-sulfur protein PsaC
  KO
K02691  photosystem I subunit VII
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00195  Photosynthesis
gei01100  Metabolic pathways
Module
gei_M00163  Photosystem I
gei_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    GEI7407_2241
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gei00194]
    GEI7407_2241
Photosynthesis proteins [BR:gei00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    GEI7407_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_9 Fer4_7 Fer4_10 Fer4_21 Fer4_17 Fer4_16 Fer4_4 Fer4_2 Fer4_22 Fer4_3 Fer4_13 Fer4_8 Fer4_18 ETF_QO Fer4_15
Motif
Other DBs
NCBI-ProteinID: AFY66720
UniProt: K9S984
Position
2762617..2762862
Genome map
AA seq 81 aa AA seqDB search
MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattcagtcaagatctatgacacttgcattgggtgcacccaatgcgtgcgggca
tgccctacggacgtactagagatggtgccctgggatggatgcaaagctggacaaattgct
tcctcccctcggactgaagactgcgttggctgcaagcggtgcgagactgcttgccccacg
gactttttgagcatccgggtttatctcggcgcagagaccactcgcagcatgggcttggct
tactaa

DBGET integrated database retrieval system