KEGG   Geitlerinema sp. PCC 7407: GEI7407_2242Help
Entry
GEI7407_2242      CDS       T02366                                 

Definition
(GenBank) glutamine--fructose-6-phosphate transaminase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00250  Alanine, aspartate and glutamate metabolism
gei00520  Amino sugar and nucleotide sugar metabolism
gei01100  Metabolic pathways
gei01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GEI7407_2242
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GEI7407_2242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gei01002]
    GEI7407_2242
Enzymes [BR:gei01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     GEI7407_2242
Peptidases [BR:gei01002]
 Cysteine Peptidases
  Family C44
   GEI7407_2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4
Motif
Other DBs
NCBI-ProteinID: AFY66721
UniProt: K9S9T7
Position
2763274..2765187
Genome map
AA seq 637 aa AA seqDB search
MCGIVGYIGTQAASGILLEGLRKLEYRGYDSAGIATVWDGELQCVRAKGKLYNLQEKLES
VATPSHIGIGHTRWATHGKPEEHNAHPHLDTDMRVAVVQNGIVENYRELRDALRSRGVEF
RSETDTEVIPHLIAEHLQALSPDENLPAGSRLLEAVRRTVNQLEGAFAIAVVSADYPNEL
VVARQQAPLSLGFGQGEFFCASDTPALIPHTRAVLTLDNGEMARLTSLGAEVYTFGGKRL
MKSPRLLNWNPVLVEKQGFKHFMLKEIYEQPGVVRTCLESYLNSQWQPETDSPEDGRSPL
TLGLSPDLYEDLERVQIVACGTSWHASLVGKYLIEQLAGIPTMVQYASEFRYSPSPLTPN
TLTIGVTQSGETADTLAALDMEQQRRADRPPEFRARLLGITNRPESSLGHLVPHIIDTHA
GIEIGVAATKTFLGQLMAFYGLALELAYRRKTLTPPQIAEIIAGLRQLPASIELILETQE
RYIEDLAHHFAETQDFIFLGRGVNFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLD
AKVPVVAIAVPGSVYDKVLSNAQEAKARDSRLIGVTATSDAHAAEIFDDMLPIPEVPELL
SPVLTVIPLQLLAYHIAARRGLDVDQPRNLAKSVTVE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggctacattggcacccaggcagccagcggaattctcctcgaagga
ttgcggaaacttgagtaccggggctacgattcggccggtatcgcgacggtctgggacggc
gagctccagtgcgtgcgggccaagggcaagctctacaaccttcaggaaaagctagagagc
gtcgccaccccctcccacatcggcattggtcacacccgctgggcaacccacggcaaaccc
gaggaacacaatgcccacccccacctcgacacggacatgcgcgtcgccgtggtccaaaac
ggcatcgtcgagaactatcgagagctgcgagacgcattacgcagccgcggcgtggagttt
cgctcggaaaccgacacggaagtcattccccacctgatcgccgagcacctgcaagcgctg
tcgcctgacgaaaatctgcccgccggatcgcggctcctagaggcggtgcggcgcaccgtc
aaccagctagagggggcgtttgcgatcgccgttgtgtctgccgactatcccaacgagctg
gtggttgcgcgccagcaggctcccttgtccctgggctttggccaaggggagtttttctgc
gcgtcagacaccccggccctgattccccacacccgggcggtcctgaccctcgacaatggc
gaaatggcccgcctcacctccctgggggcagaagtgtatacctttggcggcaagcgcctc
atgaagtcgccgcgcctgctgaactggaaccccgtcttggtggaaaagcagggcttcaag
cacttcatgctcaaggaaatctatgagcagcccggagtggtgcggacctgcctggagtcc
tatctcaacagtcagtggcagccagaaaccgactcccccgaagacgggcgatcgcccctg
accctgggtctgtcgccagacctctatgaagacctcgagcgcgtgcagatcgtcgcctgc
ggcaccagctggcacgccagcctggtcggcaagtacctgatcgagcagctcgctggcatc
ccgacgatggtccagtacgcctcggagtttcgctactctccctcgcccctgacgcccaac
accctgaccatcggcgtcacccagtccggcgaaaccgccgacacgctggcagctctggac
atggagcagcagcgccgcgccgatcgccccccggagtttcgcgcgcgcctcttgggcatc
accaaccgccccgagagctctctgggccacctggttccccacatcatcgatacccacgcg
ggcatcgagatcggcgtggccgccacgaaaactttcctcggccagctgatggctttctat
gggctggccctggagctggcctaccgccgcaagaccctcacgccgcctcaaatcgcggag
attattgctggtctgcgccagctgccagcttctatcgagctgatcctggaaacccaggag
cgctatatcgaggatctggcgcaccattttgctgaaacccaggacttcatcttcttgggc
cggggggtcaatttcccgatcgctctggagggagccctgaagctcaaggagatcagctac
atccacgcggagggttatccggctggggagatgaagcatggcccgatcgcgctgctggat
gccaaggtgccggtggtggcgatcgccgttccggggtcggtctacgacaaggtgctctcc
aacgcccaagaggccaaggcgcgggactccaggctgatcggggtcacggccaccagcgac
gcccacgctgccgagatctttgacgacatgctgccgattccggaggtgccggagctgctg
tcgccggtgctgacggtgattccactacagctcttggcgtaccacatcgcagctcgccga
ggcctcgacgtcgatcagccccgcaacctcgccaaatcagtcacagtcgagtag

DBGET integrated database retrieval system