KEGG   Geitlerinema sp. PCC 7407: GEI7407_2243Help
Entry
GEI7407_2243      CDS       T02366                                 

Definition
(GenBank) protein of unknown function DUF74
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjQ_1
Motif
Other DBs
NCBI-ProteinID: AFY66722
UniProt: K9S7W2
Position
2765652..2765981
Genome map
AA seq 109 aa AA seqDB search
MDDKFTTTAFDLPGYKIVRNLGVARGVTVRSRSLAGNFIISLQLLFGGNITLFTQLCILT
RQEAYELMIQQAKKLGANAVIGIRYDSTEISAGVAECLCYGTAVFVEPK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaatttacaactacagcctttgatttaccaggatacaaaatcgtaaggaat
cttggtgttgctcgtggagttactgttcgatctcgtagtttggcaggtaattttataata
tctttacaacttttgttcggaggaaatattacactctttactcaattatgtattcttact
cgacaagaagcatatgaattaatgattcaacaggcaaagaaactaggtgcaaatgctgta
attggtatccgctatgattcaacagagatttcggctggtgtagctgaatgcttatgttac
ggaacagcagtctttgttgagcctaagtaa

DBGET integrated database retrieval system