KEGG   Geitlerinema sp. PCC 7407: GEI7407_2258Help
Entry
GEI7407_2258      CDS       T02366                                 

Definition
(GenBank) Recombination protein MgsA
  KO
K07478  putative ATPase
Organism
gei  Geitlerinema sp. PCC 7407
Brite
KEGG Orthology (KO) [BR:gei00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    GEI7407_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N Methyltransf_23 Sigma54_activat AAA_16 AAA_22 AAA_14 AAA_5 Mg_chelatase AAA_33 AAA_2 AAA_30 AAA_18 AAA_19 Sigma54_activ_2 IstB_IS21 DUF4350 AAA_24 RNA_helicase AAA_28 AAA_3 Methyltransf_25 Methyltransf_31 NB-ARC TIP49 AAA_13 Zeta_toxin Viral_helicase1 Cons_hypoth95 NACHT Parvo_NS1 ABC_tran AAA_11 SKI ATPase_2 AAA_25
Motif
Other DBs
NCBI-ProteinID: AFY66733
UniProt: K9S948
Position
complement(2782025..2784274)
Genome map
AA seq 749 aa AA seqDB search
MDLFEQHRLQVTEAEAPLAARMRPRVLEEFIGQDHMIGPGRLLRRAIQADQLSSLIFYGP
PGTGKTTLARVIANSTRAHFIALNAVLAGVKDIREAIATAQERRGRYDQRTLLFVDEVHR
FNKAQQDALLPWVENGTVILIGATTENPYFEVNKALVSRSRIFQLRSLTAADLRAIAQQA
LQDRERGYGDRSVKLAPEALDHLVNVANGDARALLNALELAVETTPPDETGAIAISLAVA
EESIQRRAVLYDKEGDAHFDTISAFIKSVRGSDPDAALYWLARMVYGGEDPRFLFRRLLI
LASEDVGLADPQAVVVVNACAQAFDRMGLPEGHYPLAQATLYLATAPKSNSVMGFFDALT
AVKQEREAEVPNPLKDASRDRQSMGHGEGYRYPHAYRDHWVAQQYLPRSLQGQVFYQPSD
QGYEAQIGETVERRREAQIAAVLDSQAIDPLEVLTFGPRDRALDRWLQRTLDQMGEHWGH
LRDRLFALAPFQRHQVVLDLNAGSGLLTWEALRRVPEGGVYAWVQTAAEAESLREQAAAL
PSLHQPTILTGDWSALEANLTAIAPGIRFDRIVGRNLFIQAADKSAIARQLAALLPPEGT
LLLAEALPRHSQRLYPWLAAETLDADLYQRWIAAEERIYTDPANPLVNWDETDLVQALEA
AGLTVRLQVEPWITGRTLTPAVIQSWFSDRTDPPSYATHLAASLTPDEIAHLHQRFQQTL
AHQQRPWRRAIAFCTIRPAAAGPDLAASP
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtttgagcagcaccgattgcaggtgacagaagcagaggcgcctctggcggct
cggatgcgtcctcgggtgctggaggagttcattggtcaggatcacatgattggtccgggg
cgtctgctgcggcgggcgatccaggcggaccagctgtcgtcgctgattttctatggaccg
ccgggcacgggtaaaaccacgctggcgcgggtgatcgccaatagcacccgcgcccatttt
attgccctcaacgcggtgctggcgggggtgaaagacattcgggaggcgatcgcgacggcc
caggaacggcgaggacgctacgaccagcggacgctgctgtttgtcgatgaggtgcaccgc
ttcaacaaggcgcagcaggatgcgctgctgccgtgggtggaaaatggcacggtgattttg
attggggcgacgacggagaatccctattttgaggtgaataaggcgctggttagccgatcg
cggatttttcagctgcgatcgctgacggcggcggatctgcgggcgatcgcgcagcaggcc
ctccaagatcgcgagcggggctacggcgatcgctcggtgaagttggccccagaggccctc
gatcacctggtcaacgtggccaatggtgacgcccgcgccctgctgaacgccctagagcta
gcggtcgaaaccacgccccccgacgagaccggcgcgatcgcgatttccctggcggtggcg
gaggagtcgatccagcggcgggcagtcctctatgacaaagaaggggacgcccacttcgat
accatcagcgcctttatcaagagcgtgcgcggttcggaccccgatgcggcgctctactgg
ctggcccgcatggtctacggcggcgaggacccccgctttttgtttcggcggctgctgatc
ctggccagcgaggatgtggggctggccgacccccaggcggtggtggtggtcaatgcctgc
gcccaggcctttgaccggatggggttgccggagggccactatcccctggcccaggcgacg
ctgtacctggcgacggcccccaagtccaacagcgtgatgggcttttttgatgctttgacg
gcggtgaagcaggagcgcgaggccgaggtgcccaatcccctcaaggatgctagccgcgat
cgccagtctatgggccacggcgagggctaccgctatccccacgcctaccgagatcactgg
gtggctcagcaatatttgccgcgatcgctccagggacaggtgttttatcagccctcggat
cagggctacgaagcccagatcggcgagacggtggagcggcggcgggaagcccagatcgcg
gcggtcctagacagccaagcgatcgatccgctggaggtgctgaccttcgggccgcgcgat
cgcgccctcgatcgctggctgcagcgcaccctagaccagatgggcgagcactggggacac
ctacgcgatcgcctgtttgccttagcgccgtttcagcgccaccaggtcgtgctggatctc
aacgcgggcagcggcttgctgacctgggaggccctgcggcgcgtgcccgagggcggcgtg
tatgcctgggtgcagacggcggcggaggccgaaagcctgcgggagcaggcggcggctttg
ccttcgctgcaccagccgacgatcttgacgggagactggagcgccctagaagcaaatctg
acggcgattgcccccggcattcgcttcgatcgcatcgtgggccgcaatctcttcatccag
gctgccgacaaaagcgcgatcgctcgtcagcttgcggccttgctgccgcccgaagggacg
ctgctcctggccgaagccttgccccgccacagccagcgcctctatccgtggctagccgct
gagaccttggacgctgacctgtatcagcgctggatcgcggctgaggagcgcatctacacc
gaccccgccaatcccctggtgaactgggacgagacggatttggtgcaggcgctcgaggcg
gcgggcctgacggtgcggctccaggtagagccctggatcaccggtcgcaccctgaccccg
gccgtgatccagagctggtttagcgatcgcaccgatccacccagctacgccacccacctg
gccgccagcctgacccccgatgaaatcgcccacctgcaccagcgctttcagcagaccctg
gcccaccagcagcggccctggcggcgggcgatcgccttttgcactattcgaccggccgcg
gcgggtccagatttggcagcgtcaccgtaa

DBGET integrated database retrieval system