KEGG   Geitlerinema sp. PCC 7407: GEI7407_2266Help
Entry
GEI7407_2266      CDS       T02366                                 

Definition
(GenBank) photosystem II protein PsbI
  KO
K02710  photosystem II PsbI protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00195  Photosynthesis
gei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    GEI7407_2266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gei00194]
    GEI7407_2266
Photosynthesis proteins [BR:gei00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    GEI7407_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsbI LapA_dom
Motif
Other DBs
NCBI-ProteinID: AFY66741
UniProt: K9S9W1
Position
complement(2793559..2793675)
Genome map
AA seq 38 aa AA seqDB search
MLTLKIAVYLVVAFFVGLFVFGFLSNDPARTPNRRDME
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgctgactttgaaaatcgctgtttatctcgtcgttgcattttttgttggcctgttcgtc
tttggcttcctctcaaatgaccctgctcggacccccaaccgccgggatatggagtaa

DBGET integrated database retrieval system