KEGG   Geitlerinema sp. PCC 7407: GEI7407_2268Help
Entry
GEI7407_2268      CDS       T02366                                 

Definition
(GenBank) Tetratricopeptide TPR_1 repeat-containing protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_16 TPR_8 TPR_17 TPR_14 TPR_12 TPR_19 TPR_6 TPR_11 ANAPC3 TPR_9 TPR_7 TPR_10 Fis1_TPR_C
Motif
Other DBs
NCBI-ProteinID: AFY66743
UniProt: K9S959
Position
2796407..2796877
Genome map
AA seq 156 aa AA seqDB search
MNDPQIQSLLDDLKNSDATVRDRATEALWRLWFQQKGLYGWEILQQAQTLLENQQIQDAE
AMLTELVGDQPDFAEAWNRRAVLHYTQSRYRQSLHDCQKVIELNPIHFGALHGLGLCHAM
LGEYREAISAFRRALEIQPYSTLNQRLLLECTARLS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcctcaaattcagtctctcctggacgatctcaaaaactctgacgcgaccgtg
cgcgatcgcgcgactgaggcgctttggcggctttggtttcagcaaaaaggactctacggc
tgggagatcttgcagcaggcccaaactctgctggaaaatcagcaaattcaggatgctgag
gcgatgctgacggagctggttggcgatcagccggactttgcagaggcctggaaccggcga
gccgtcctccactacacccaaagccgctaccgccagtctctccacgactgccaaaaggtc
atcgagctcaatcccattcactttggggcgctgcacggcctggggctttgccatgccatg
ctgggagaatatcgagaggcgattagcgcttttcggcgggctctggagatccagccttac
agcacgctcaatcagcgcctgctgctggaatgcacggcgcgcttgagctag

DBGET integrated database retrieval system