KEGG   Geitlerinema sp. PCC 7407: GEI7407_2270Help
Entry
GEI7407_2270      CDS       T02366                                 

Definition
(GenBank) hypothetical protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: AFY66745
UniProt: K9S9A6
Position
complement(2797638..2797889)
Genome map
AA seq 83 aa AA seqDB search
MKDKLLSWLNLFLMADVFVVLFSFFWLAIAVLGRSMNLSLGLDLWYKLWEPVFTPAIGLL
MGGALLSGLISQINKRLRARDSQ
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaagctactttcctggctcaatcttttcctgatggccgacgtttttgtagtt
ttgtttagtttcttttggctggcgatcgccgtcctcggccgctccatgaacctcagcctc
ggcctcgatctttggtacaagctctgggagcccgtcttcactcccgccatcggtcttctg
atgggcggtgcccttctcagcggcctgatcagccaaattaacaagcgtctgcgcgcccga
gattctcagtag

DBGET integrated database retrieval system