KEGG   Geitlerinema sp. PCC 7407: GEI7407_2287Help
Entry
GEI7407_2287      CDS       T02366                                 

Definition
(GenBank) hypothetical protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3086 Prefoldin_2 APG6 TMCO5 GAS DUF1192 bZIP_1 HAUS-augmin3 DUF4407 FlxA DUF3584 Spc7 Macoilin Uds1 DivIC Mnd1 FapA bZIP_2
Motif
Other DBs
NCBI-ProteinID: AFY66762
UniProt: K9S829
Position
2813702..2814772
Genome map
AA seq 356 aa AA seqDB search
MNSDAFPPSDSGQSIPSGADQPEGTPGQELAHGEVRELERRIADLRRQEERLRKEVADLQ
ATYDRTLREQMVQAQMMMGQVVQEGLADLEQRKQALQIAVEQLERRQERIRTEMRTTFAG
TSQDLAIRIQGFKDYLVGSLQDLAAAAEQLQLVREAPEPEMKPVRDAEPAELAKPDFGEQ
SFEEQTRLIRRMLDQFRDRPDYYGPPWQLRRTFEPIHAERVSKWFFDQGGKGALKSMGSR
LQNILVASAAIAILRRMYGDRLWPLVLANSPERLGEWRRGLQDCLGITRADFGPDQGIVL
FEAAEPLALKADRLEQEGDLPLIIIDDTENQVSLSLLQFPLWLAFAPDPTYSTPFI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgacgcatttcccccctctgactctggccaatcgatcccctctggcgctgac
cagcccgaggggactccgggacaggagctcgcccacggagaagtccgggagctagagcgc
cggatcgcggatctgcggcgccaggaagagcgcctgcgcaaagaggtggctgatctgcag
gcgacctacgaccggacgctcagagagcagatggtgcaggcccagatgatgatggggcag
gtggtgcaggaagggctggccgatctggagcagcgcaaacaggcgctgcagattgcggtg
gagcagctggagcggcgccaagagcgcattcgcacagagatgcggacgacatttgcgggc
acctcgcaggacctggcgattcgaatccagggcttcaaggattatttggtgggcagcttg
caggatctggcggcggcagcggagcagctgcagctggtgcgcgaagcgccggagccggag
atgaagccggtccgagatgcggagccagcggagctcgccaagcccgattttggtgagcag
agcttcgaggagcagacgcgcttgattcggcggatgctggatcagtttcgcgatcgcccg
gactattatgggccgccgtggcagctgcggcggacgtttgagccgatccatgcggagcgg
gtgtccaagtggttttttgaccaaggggggaaaggtgccctcaagagcatgggcagccgt
ctgcaaaatattttggtggcctcagccgcgatcgcgattttgcggcgcatgtacggcgat
cgcctctggcccctggtgttggccaacagccccgagcgcctcggcgaatggcggcgcggt
ctccaggactgtctgggcatcacgcgggcagactttggcccggatcagggcattgtgctg
tttgaggcagcggagcccctggccctcaaggccgatcgccttgagcaagagggcgacctg
cccctgatcatcatcgacgacaccgagaatcaagtcagcttgtctttgctccagttcccg
ctgtggctagcctttgcccccgatccgacctactcgactccctttatctag

DBGET integrated database retrieval system