KEGG   Geitlerinema sp. PCC 7407: GEI7407_2294Help
Entry
GEI7407_2294      CDS       T02366                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE HTH_23 Sigma70_r4_2 HTH_24 HTH_40
Motif
Other DBs
NCBI-ProteinID: AFY66769
UniProt: K9SAJ2
Position
2823562..2824218
Genome map
AA seq 218 aa AA seqDB search
MPLLILVAEDDPGTRLSIEHYLELSGYSVVAAENGKEALELVSSYQPHLIVTDVVMPQMD
GYEFVRRVRQQPPFRLLPVIFLTARSTTEERILGYQLGCDAYLPKPFDLQELGAVVRNLL
ERSQLIQSEWRLHAQPPYQENRAIDTLEESDLSPVSLTVREQEVLRLLTDGLSNIQIGDS
LHLSPRTVEKYVSSLLRKTSTNNRAELVRFALQHHLVQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgctaattttagtcgctgaggacgatccagggactcgcctgtcgattgagcac
tatttagagttatctggatactcagttgttgctgccgaaaatggcaaagaagccctggaa
ctggtctccagttaccaacctcatctgatcgtgacggatgtggttatgccacaaatggat
ggctacgagtttgtacgacgggtgcgccaacagccgccgtttcgcctgctgccggtaatt
tttttgacggcgcgatcgacaacggaagagcgaattttgggctatcaactgggctgtgat
gcctatttgccaaagccttttgacttgcaggagttgggggcggtggtgcgcaatcttttg
gagcgatcgcagctgattcagtccgagtggcgcctccacgcacagccgccctaccaggaa
aatagggcgatcgacaccctagaagagtctgatctttcacccgtcagcctaaccgtccgc
gagcaagaggttttgcgcttactgacggacggcctctccaatattcagatcggcgacagt
ctgcacctgagcccccgcacggtggagaaatacgtcagcagccttttgcgcaagacatcg
accaataaccgagcggagcttgtccgcttcgcgctccagcatcacttggtgcagtag

DBGET integrated database retrieval system