KEGG   Geitlerinema sp. PCC 7407: GEI7407_2301Help
Entry
GEI7407_2301      CDS       T02366                                 

Definition
(GenBank) Tetratricopeptide TPR_1 repeat-containing protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_11 TPR_2 TPR_16 TPR_9 TPR_8 TPR_17 TPR_14 TPR_12 TPR_19 TPR_6 TPR_7 TPR_15 BTAD Wzy_C_2
Motif
Other DBs
NCBI-ProteinID: AFY66776
UniProt: K9SA22
Position
complement(2830314..2831177)
Genome map
AA seq 287 aa AA seqDB search
MTQNAMVRRVYRWLGWKIAIAALTLVCCLGWLPPAAASKISDFPRAEALTEESLADLESL
YQAALAATQNGNFVLAEDIWTQAIALFPENPASWSNRGNARMSQNKLQAALEDYNQSVTL
APDLPDPYLNRGVVFERLEDWDAAIADYNQALSFNPQDPVAYNNRGNAEAGARQWQAAIA
DYQHAVDLAPAYAAARANYTLALWQNGDLPAAIRQMRNLIRKYPQFADMRAALTAALWQT
GQRGEAESNWFAAVGLDRRYKDLTWVQQIRRWPPVAVEALDNFLAIR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaacgccatggttagaagggtttatcgctggctcggctggaaaattgcgatc
gcggctttgacccttgtctgttgtctaggctggctgcccccggcagcggcgtcgaaaatc
tcggattttccccgtgctgaggccctgaccgaagagagtctggcggatctcgaatccctt
tatcaagcggccctcgccgccacccagaacggcaactttgtcttggcggaggacatttgg
acccaggcgatcgccctgttccctgagaatccggcttcctggagcaaccggggcaatgcg
cggatgagccaaaataagctgcaagccgccctagaagactacaaccagtcggtgaccctc
gcaccggacctgcccgacccctacctcaaccggggagtggtgtttgagcgcttggaggac
tgggacgccgcgatcgccgactacaaccaggccctgagctttaatccccaggacccagtc
gcctacaacaatcgcggcaacgccgaagcgggtgcccgccagtggcaagcggcgatcgct
gactaccagcacgccgtggatctcgcccccgcctacgcggcggcccgcgccaactacacc
ctcgccctctggcagaacggggatctgccggccgccatccggcaaatgcgcaacctaatt
cgcaagtatccccagtttgctgacatgcgggcggcgctcacggctgccctctggcaaacg
ggccagcggggcgaagccgagagcaactggtttgcggccgtcggcctcgatcgccgctac
aaggacctcacctgggtgcagcagattcgccgctggccgcccgtcgccgtcgaggccctc
gacaactttttggcgatccgctga

DBGET integrated database retrieval system