KEGG   Geitlerinema sp. PCC 7407: GEI7407_2320Help
Entry
GEI7407_2320      CDS       T02366                                 

Definition
(GenBank) ABC transporter related protein
  KO
K09691  lipopolysaccharide transport system ATP-binding protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei02010  ABC transporters
Module
gei_M00250  Lipopolysaccharide transport system
Brite
KEGG Orthology (KO) [BR:gei00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GEI7407_2320
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00250] [OT]
    GEI7407_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzt_C ABC_tran AAA_29 AAA_21 AAA_23 SMC_N AAA_30 AAA_15 DUF11 RsgA_GTPase AAA_16 NACHT AAA_22 CARDB Zeta_toxin DUF4625 DUF3093
Motif
Other DBs
NCBI-ProteinID: AFY66795
UniProt: K9S9H7
Position
2853022..2854314
Genome map
AA seq 430 aa AA seqDB search
MSNVAIALKNISKCYRLYRRPSDRLKELLIPGKLRAREFWALRNISLEVKEGETLGIVGQ
NGSGKSTLLQIIAGTLTPSEGEVTVNGRVAALLELGSGFNPEFTGRQNVFFNGQILGLAR
EEVEAKFDAIAAFADIGEFIDQPVKTYSSGMAVRLAFAVVAHTEPRILIVDEALAVGDAK
FQVRCMQRIRQMKDQGVTILFVSHDASSVKMLCDQAILLHHGEAIRSGQPREVVNYYIEL
LNSGSTQPAADVSETATSPEELASIRRTTAAQGADDVELKARRYGTKLAVFQEIKITDAH
GQEAEKLETGSTFHISISLEAMAELSDLVVGISIRNLMGVVMYGTNTYHLDSKLPSLEAG
QTITLTFQLPCQLNRGVYTVTVGAHSEGGLSYDWVDELVVFEVYNTSQCEGFVDLASEVR
YEVLSSALPS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatgtagccattgccctcaaaaatatttccaagtgctaccggctttatcgccgt
ccctccgatcgcctcaaagaattgctcattccgggcaagctaagggctcgggaattctgg
gctttgcgcaatatcagcctagaggtcaaagagggcgaaaccctgggcatcgtcggccaa
aacggctcgggcaagagcacgctgctgcaaatcatcgcgggaacgctgaccccctccgag
ggcgaggtgacggtgaatggtcgcgtggcggcgctgctggagctaggcagcggcttcaac
ccggaattcaccggtcgccagaacgtctttttcaacggccagattctggggctagcgcgc
gaagaggtggaggcaaagtttgatgcgatcgccgccttcgcggacatcggcgaattcatc
gatcagcccgtcaaaacctactccagcggcatggccgtgcggcttgcctttgcggtggtg
gcccacaccgaaccccgcatcctgattgtggatgaggccctggcggtgggcgacgccaag
ttccaggttcgctgcatgcagcggattcgccagatgaaggaccagggcgtgacgatcctg
ttcgtgtcccacgatgcgtccagcgtgaaaatgctgtgcgatcaggccatcttgctgcac
cacggcgaggcgatccgctcagggcagccccgggaggtcgtgaactactacatcgagctg
ctcaactctggcagcacccagcccgccgccgacgtctccgaaacggccacgtcaccggag
gagctggcgtcgattcgccggacgacagcagcccagggcgctgacgatgtagagctgaaa
gctcgccgctacggcaccaaattggcggtgtttcaggaaatcaaaatcaccgatgcccac
ggccaagaggcagagaagctggaaacgggcagcacctttcatatctcgatttccctagag
gcgatggcggagctgtcggacctggtcgtgggcatctcgatccgcaacctgatgggggtg
gtgatgtacggcaccaatacctaccacctcgacagcaagttgccctctctggaggccggt
cagaccatcacactgaccttccagctgccctgccagctcaatcgcggcgtctacacggtg
acggtgggggcgcactcggagggcggcctgagctacgactgggtggatgagctggtggtg
tttgaggtctacaacaccagtcagtgcgagggatttgtggatttggcgtcggaggtgcgc
tacgaagtgctgtcttcggcgctgccatcttag

DBGET integrated database retrieval system