KEGG   Geitlerinema sp. PCC 7407: GEI7407_2333Help
Entry
GEI7407_2333      CDS       T02366                                 

Definition
(GenBank) chorismate lyase
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00130  Ubiquinone and other terpenoid-quinone biosynthesis
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    GEI7407_2333
Enzymes [BR:gei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     GEI7407_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF98
Motif
Other DBs
NCBI-ProteinID: AFY66808
UniProt: K9S9D9
Position
complement(2863661..2864215)
Genome map
AA seq 184 aa AA seqDB search
MWSGDEDVVRQGLPHEQLAPTWQLLLLGDGSPTRHLQLLTGEPTEVDVIDMSPVGIDTDH
APELIKMVPGPRLRRQVWLRTASGQRLAYAASWWEASHVDEYLQNRSLPIWASLARLRTE
LYRDVQGIHYGHSPALEQAFGQSGPFWGRHYLFWHHGQPLTLIYEVFSPYLERYLGPAKL
PKMK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtccggtgacgaagacgtagtgcgacagggattgccccatgagcaactcgcccct
acttggcagctgctgctcttgggggatggctcaccgacccggcacctccagctcctcacc
ggagaaccgacggaagtagacgtgatcgacatgtccccagtgggcatcgacacagaccat
gcgcccgaactgatcaagatggtgccagggcctcgcctgcggcgacaggtctggctgcgg
acggcctccggccagcgcttggcctatgctgcctcctggtgggaagccagtcacgtagac
gagtacttgcaaaaccgatcgctaccgatctgggccagtctggcgcggctgcggaccgag
ctgtatcgcgacgtccagggtattcactacggccactcgcccgccctagagcaagctttt
ggacaatcagggccattttggggccgccactacctgttttggcaccatggccagccccta
acgctgatttacgaggttttctctccctatttggagcgctatcttggccccgcaaaactg
ccaaaaatgaaataa

DBGET integrated database retrieval system