KEGG   Geitlerinema sp. PCC 7407: GEI7407_2462Help
Entry
GEI7407_2462      CDS       T02366                                 

Definition
(GenBank) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00860  Porphyrin and chlorophyll metabolism
gei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_2462
Enzymes [BR:gei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     GEI7407_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_31 Methyltransf_25 GidB Methyltransf_24 MTS PCMT RrnaAD Methyltr_RsmB-F Cons_hypoth95 DOT1 Methyltransf_3 Methyltransf_5 Met_10 Methyltransf_18 PrmA Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AFY66937
UniProt: K9S8I6
Position
3012677..3013279
Genome map
AA seq 200 aa AA seqDB search
MPCQLWPYTTPGITDDLFEGLPGIPMTKREVRLLILSQLRLKKDAVFWDIGAGTGTISVE
VGLLCPEGRIVAVERDEEVAALIRRNCDRFEVGNIQVIEGNAPECLEALADSPDCVCIEG
GRSVREILTAVWPRLRSPGRVVAIASNLEGLYAISESFSALQARNIEVVQSAVNRLEKRG
IHQTFAAADPLFVLSAEKLS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtcaactctggccctacaccactcctggcatcactgacgacctgtttgaagga
ttgcccggcattcctatgaccaagcgggaagtgcgcctgctgatcttgtcccagctgcgg
ctgaaaaaagatgcggtgttttgggatatcggcgctggcaccggcacgatttcggtggag
gtggggctgctgtgtcccgaggggcgcattgtcgcagtggagcgagatgaagaagtggcg
gccttgattcggcgcaactgcgatcgctttgaggtgggcaatattcaggtgatcgagggc
aatgcgcccgagtgcctggaggctctggctgattcgccggactgcgtttgcatcgagggc
gggcgatcggtgcgggaaatcttgacggcggtgtggccgaggctgcgatcgccggggcgc
gtggtggcgatcgccagcaacctcgagggcctctacgccatctcagagagcttttcggcc
ctccaggcccgcaacatcgaggtggtccagtccgccgtcaatcgcctcgaaaagcgcggc
atccaccaaacctttgccgccgccgaccccctctttgtcctgagtgccgaaaagctgagc
tag

DBGET integrated database retrieval system