KEGG   Geitlerinema sp. PCC 7407: GEI7407_2916Help
Entry
GEI7407_2916      CDS       T02366                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00860  Porphyrin and chlorophyll metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_2916
Enzymes [BR:gei01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GEI7407_2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 ABC_tran AAA DUF815 AAA_18 AAA_27 AAA_30 AAA_28 MMR_HSR1 FtsK_SpoIIIE AAA_33
Motif
Other DBs
NCBI-ProteinID: AFY67386
UniProt: K9SBR7
Position
3595166..3596293
Genome map
AA seq 375 aa AA seqDB search
MSSTVPASTSAKATRRPIFPFSAIVGQEEMKLALMLNVIDPKIGGVMIMGDRGTGKSTTI
RALADLLPEIEVVADDPFNSDPRDPELMSDDVRARVENGTELPVARKKVLMVDLPLGATE
DRVCGTIDIEKALAEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTV
EREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPNLRVQIVEQRSEFD
QDPPSFLEKYQAQQDEIQQKLVSARDRLPSVTIAHNMKVQISQVCAELDVDGLRGDIVTN
RAAKALAAFEGRTEVTVNDIQRIIALCLRHRLRKDPLESIDSGYKVEKIFCRVFGLPDPE
ANNSATNGVGQLSAR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagttctactgtcccagccagcacctcagccaaagcaacccgccgccccatctttccc
tttagcgccatcgtgggccaagaggagatgaagttggcgctgatgctaaatgtcatcgat
cccaaaattggcggggtgatgattatgggcgatcgcggcacgggtaaatccaccaccatc
cgcgccctcgcggacctgctgcccgagattgaagtcgtcgccgatgaccccttcaacagc
gatccgcgcgacccagaactgatgagcgatgacgtgcgcgcccgcgtcgagaacggcacc
gagctccccgtcgctcgcaaaaaagtcctgatggtcgacctgcccctcggtgctaccgag
gaccgcgtctgcggcaccatcgacatcgaaaaagccctcgccgaaggcgtcaaagccttt
gaaccggggctgcttgccaaggccaaccgcggcattctctacgtggacgaagtcaacctg
ctcgacgaccacctggtcgacgtgctgctcgactccgccgcttccggctggaacaccgtg
gagcgggaaggcatctccattcgccaccccgcccgctttgtcctcgtcggctcgggcaac
cccgaggagggcgaactgcgtccccagctgctcgatcgcttcggcatgcacgccgagatc
cgcacggtgaaagagccgaacctgcgcgtccagatcgtcgaacagcgatcggagtttgac
caagatcctccgagcttcctggagaagtaccaagctcagcaggacgagatccagcaaaag
ctggtcagcgcccgcgatcgccttccctctgtgacgatcgcccacaacatgaaagtgcag
atctcccaagtgtgcgccgagctcgacgttgacggtctgcgaggcgacatcgtcaccaac
cgcgccgccaaagctctggccgccttcgagggccgcaccgaagtcaccgttaacgacatc
cagcgcatcatcgccctgtgcctgcgtcaccgtctgcgcaaggatcccctcgagtccatc
gactccggctacaaggtcgagaagatcttctgccgcgtgtttgggctccccgatccggag
gcaaacaacagcgcaaccaatggcgttggccaactgagcgctcgctaa

DBGET integrated database retrieval system