KEGG   Geitlerinema sp. PCC 7407: GEI7407_3552Help
Entry
GEI7407_3552      CDS       T02366                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
gei  Geitlerinema sp. PCC 7407
Brite
KEGG Orthology (KO) [BR:gei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gei03016]
    GEI7407_3552
Enzymes [BR:gei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     GEI7407_3552
Transfer RNA biogenesis [BR:gei03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    GEI7407_3552
 Prokaryotic type
    GEI7407_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 DKCLD
Motif
Other DBs
NCBI-ProteinID: AFY68019
UniProt: K9SE04
Position
4322644..4323549
Genome map
AA seq 301 aa AA seqDB search
MQGFVNLNKPAGWTSHDCVAKVRKLLRTKRVGHGGTLDPAATGVLPIAVGKATRLLQYLP
EDKAYRATVRFGVTTATDDLEGDVLSQQAAPDLTLEAIAPLLTQFLGTINQIPPRYSAIQ
VDGKRLYDRARAGEDFEVPARTVEVYDIRVLEWRSQAYPELDLEIACGPGTYIRSIARDL
GAAAGTGAALAQLQRTASCGFRLQDSLSLEELAAALEGDRLPLTEPNDALRHLPTIQLSE
PLVALWLNGRRLPLAELGDLEPGIATAPSVRIQDPAGTFLGIAAIALDAEPALLVPKLVF
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaggtttcgtcaatctcaacaagccagctggctggacatcccatgactgcgtggcc
aaggtccgcaagctgttgcgcaccaagcgagtaggccacgggggcaccctggacccagca
gctacgggcgtgctgcccattgcggtgggcaaagccacgcgcctgctgcaatatttgccg
gaggacaaggcttaccgggcaacagtacgctttggggtgacgacagcaaccgatgaccta
gagggcgatgtgctctcccagcaggcagcgcccgacttgacgcttgaggcgatcgccccc
ctcctgacgcagtttttgggcaccattaaccaaattccgccccgctacagcgccatccag
gtcgacggcaagcgactctatgaccgcgcgcgggcgggcgaagactttgaggtcccagca
cggacggtcgaggtctacgatattcgggttctggagtggcgatcgcaggcgtatcccgag
ctggatctggagatcgcctgcggccccggcacctatattcgctcgatcgcgcgagacctg
ggcgccgccgcaggcaccggcgcggcgctagcccagctccagcgcaccgcaagctgcggg
tttcgcctccaggacagcctgagcctggaggagctggcagcggccctagagggcgatcgc
ctgccgctcaccgagcccaacgacgccttgcggcacctgccgacgattcagctatccgag
cccctcgtggccctgtggctcaacggtcgtcgcctgcccctagcagagctgggagacctc
gagcctgggatagccaccgctccgagcgtgcgcatccaggacccagcgggtacgttcctg
ggcattgccgcgatcgccctcgacgctgagccagcgctgcttgtgcccaagctggttttt
aactga

DBGET integrated database retrieval system