KEGG   Geitlerinema sp. PCC 7407: GEI7407_3815Help
Entry
GEI7407_3815      CDS       T02366                                 

Definition
(GenBank) Mg-protoporphyrin IX methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00860  Porphyrin and chlorophyll metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_3815
Enzymes [BR:gei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     GEI7407_3815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_11 CMAS PrmA Methyltransf_32 MTS TehB Methyltransf_18 Ubie_methyltran CheR DREV NodS UPF0020 Herpes_glycoH_C Methyltransf_16 Met_10 DUF4885 YukC HicA_toxin
Motif
Other DBs
NCBI-ProteinID: AFY68282
UniProt: K9SCF5
Position
4636976..4637665
Genome map
AA seq 229 aa AA seqDB search
MNATDDKTVVREYFNAVGFDRWRRIYGQTDDINKVQLDIRTGHQETVDTLLGWLKADGGL
EGLTVCDAGCGVGSLSIPLGAAGAKVYATDISEKMVGEAKERAQAELGASNSITFEVKDL
ENLSGKYHTVVCLDVIIHYPQEQAAQMIAHLSSLAESRLVVSFAPKNLFYSALKQIGNLF
RGPSKATRAYLHSEAEVVKTLKSLGWEVKRRNQVSTRFYFSCMLEATRA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaccgacgacaaaaccgttgtccgcgaatactttaatgccgttggcttcgat
cgctggcggcggatctacggccaaaccgacgacatcaacaaagtccagctcgacattcgc
accggccaccaggaaaccgttgacacgctgctaggctggctcaaagccgacggcggtctg
gaagggctcaccgtttgcgatgcgggctgcggcgttggcagtctcagcattcccctaggc
gcggcgggtgccaaggtctacgccaccgacatttccgagaaaatggtgggcgaagccaaa
gagcgcgctcaggcagagctgggcgcttctaacagcatcaccttcgaggtgaaggacctc
gagaacctcagcggcaagtaccacacggtcgtgtgcctggacgtgatcattcactatccc
caggagcaagcggcgcaaatgattgcccacctgagctctctggctgagtcgcgcttggtg
gtcagctttgcgcccaagaacctcttttacagcgccctcaagcagatcgggaatctattc
cgaggccccagcaaggccactcgcgcctacctgcacagcgaagcggaagtggtcaaaacc
ctcaaaagcctgggctgggaagtgaagcgacgcaaccaagtcagcactcgcttttacttc
tcttgtatgctggaggcaactcgcgcctag

DBGET integrated database retrieval system