KEGG   Geobacillus sp. JS12: A0V43_02425Help
Entry
A0V43_02425       CDS       T04412                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00300  Lysine biosynthesis
gej01100  Metabolic pathways
gej01110  Biosynthesis of secondary metabolites
gej01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    A0V43_02425
Enzymes [BR:gej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     A0V43_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 UCH_C
Motif
Other DBs
NCBI-ProteinID: AMQ20014
UniProt: A0A142CZ12
Position
475698..476408
Genome map
AA seq 236 aa AA seqDB search
MKMMDANEIISFIQNSKKSTPVKVYIKGDLEGIDFGSSAKTFITGNVGVVFGEWQDIQAA
IEANQDKIEDYVVENDRRNSAIPLLDLKGIRARIEPGAIIRDHVEIGDNAVIMMGAVINI
GAVVGEGTMIDMNAVLGGRATVGKNCHIGAGAVLAGVIEPPSAKPVVIEDDVLVGANAVI
LEGVTVGKGAVVAAGAVVVEDVPPYTVVAGVPARVIKQIDEQTRAKTEIKQELRQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgatggacgccaatgaaatcatttcctttattcaaaacagcaaaaaatcgaca
ccagtcaaagtatacataaaaggggatctcgaaggcatcgatttcggctcaagcgcgaaa
acgtttattaccggcaacgtcggcgtcgtgtttggcgaatggcaagacattcaagcggca
atcgaagcgaatcaagacaaaatcgaggactatgtcgtcgagaacgaccgccgcaactcg
gccattccgcttttggatttgaaaggcatcagggcgcgcattgagccgggcgctatcatc
cgcgaccatgtcgaaatcggcgacaacgccgtcattatgatgggagcggtcatcaatatc
ggcgccgtcgtcggcgaaggaacgatgatcgacatgaacgcggtgctcggcggccgggcg
acggtcgggaaaaactgccatatcggcgccggcgcggtgttggcaggcgtgatcgagccg
ccatcagccaagccggtcgtcattgaagacgatgtgctcgtcggggcgaatgccgttatt
ttggaaggcgtcacagtcggcaaaggagcggttgtggctgccggcgccgttgttgtcgaa
gacgtgccgccgtatacggtcgtggctggcgtgccggcgcgcgtcattaagcagatcgac
gagcaaacgcgggcgaaaacggagattaagcaggagcttcgccaattataa

DBGET integrated database retrieval system