KEGG   Geobacillus sp. JS12: A0V43_04585Help
Entry
A0V43_04585       CDS       T04412                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00071  Fatty acid degradation
gej00072  Synthesis and degradation of ketone bodies
gej00280  Valine, leucine and isoleucine degradation
gej00310  Lysine degradation
gej00362  Benzoate degradation
gej00380  Tryptophan metabolism
gej00620  Pyruvate metabolism
gej00630  Glyoxylate and dicarboxylate metabolism
gej00640  Propanoate metabolism
gej00650  Butanoate metabolism
gej00900  Terpenoid backbone biosynthesis
gej01100  Metabolic pathways
gej01110  Biosynthesis of secondary metabolites
gej01120  Microbial metabolism in diverse environments
gej01130  Biosynthesis of antibiotics
gej01200  Carbon metabolism
gej01212  Fatty acid metabolism
gej02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0V43_04585
   00630 Glyoxylate and dicarboxylate metabolism
    A0V43_04585
   00640 Propanoate metabolism
    A0V43_04585
   00650 Butanoate metabolism
    A0V43_04585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0V43_04585
   00072 Synthesis and degradation of ketone bodies
    A0V43_04585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0V43_04585
   00310 Lysine degradation
    A0V43_04585
   00380 Tryptophan metabolism
    A0V43_04585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A0V43_04585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A0V43_04585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0V43_04585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gej04147]
    A0V43_04585
Enzymes [BR:gej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A0V43_04585
Exosome [BR:gej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0V43_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AMQ20360
UniProt: A0A142D008
Position
933529..934707
Genome map
AA seq 392 aa AA seqDB search
MSTDIVLIEGARTPFAKFCGSFREISATDLGAIAAREAMKKAGIEPEEIDHVVFGNVQQS
SRDAHLLARHVGLKAGVPIDVPAVTVNRLCGTGLETIIMAARFILTGESEVVLAGGTENM
SQVPHVIRGMRWGAPLGSPTVEDWVWDGLYDTVGGCSMAITAENLAKKYDITREEADQHA
LRSHERALTAMANGYFRQEIVSVTVQGKKGEMIVDTDEHPRKTSLEQLRALQPRFLENGV
VTPGNASGMNDGAAAVIVASGDYAAKRGLKPLARLVSWGIVGVEPQYMGIGPVPAIRQAL
DKANLSIDDLDLIEINEAFSAQYLACQKELGFDDDKGNVNGGAVALGHPLAASGTRITLT
LVYELKRRGKKYGVSSLCIGGGQGIAAIWERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggatattgtgttgattgaaggagcacgaacgccatttgctaaattttgcggt
tcgtttcgtgaaatctccgcgaccgatttaggagctattgcggcgcgggaagcgatgaaa
aaagcaggaatcgagccagaagaaatcgaccatgttgtatttggcaatgtccagcagtca
agccgggatgctcacttgcttgctcgccacgtcggcttgaaggccggggtgcccatcgac
gtgccggctgtgacggtgaaccggttgtgcggaacgggactcgagacaattatcatggcg
gcgcgctttattttaaccggagaatcggaagtggtgttggcgggaggcactgaaaacatg
agccaagtgccgcacgtcatccgaggcatgcgctggggagcaccattaggcagcccaacg
gtggaggactgggtgtgggatggtctgtatgacacagttggcggctgtagcatggctata
acagcagaaaatttagcgaaaaaatatgacattacgcgcgaagaggctgaccaacatgcc
ctccgcagccatgaacgggcgcttacggcaatggccaatgggtatttccgccaagaaatt
gtctccgtcaccgtgcaaggaaaaaaaggagaaatgatcgttgacaccgatgagcatccg
cggaagaccagtttggagcagttaagggcgcttcaaccgcgctttctcgaaaacggagtc
gtgacaccaggcaatgccagtgggatgaacgacggtgcggccgcggttattgtcgcctcg
ggggactatgctgccaagcgcggattgaaaccgctcgcccgtctcgtttcgtggggcatc
gtcggagttgaaccgcagtatatggggattggccctgttccagcgattcgccaggcactc
gacaaagcgaatttatcaattgatgacctcgacttgattgaaatcaacgaagcattttca
gcccaatatttggcttgccagaaggaactgggatttgatgatgacaaaggcaacgtcaac
ggtggggcggtcgcgcttggccatccattggcagcttcaggaacgcgcatcacgttgaca
ctcgtttatgagttgaaaagaagaggaaagaaatacggtgtttcttcactatgcatcggc
ggcggccaaggcattgcggcgatctgggaaagactgtaa

DBGET integrated database retrieval system