KEGG   Geobacillus sp. LC300: IB49_03265Help
Entry
IB49_03265        CDS       T04018                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00740  Riboflavin metabolism
gel00790  Folate biosynthesis
gel01100  Metabolic pathways
gel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    IB49_03265
   00790 Folate biosynthesis
    IB49_03265
Enzymes [BR:gel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     IB49_03265
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     IB49_03265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AKU25635
UniProt: A0A0K1K8E3
Position
complement(616817..618010)
Genome map
AA seq 397 aa AA seqDB search
MFDTIEAALDALKNGEVIIVCDDEDRENEGDFVALAEKATPDVVNFMITHGRGLVCVPIT
EELAARLGLEPMVAHNTDAHGTAFTVSIDYKTTTTGISAYERAATIQALLDPNVKASDFK
RPGHIFPLIAKQGGVLRRAGHTEAAVDLARLCGAKPAGVICEIMKKDGTMARVPDLRQIA
DQFGLKMITIKDLIAYRSQREKLVKREVDIWLPTEFGEFRAVGYTNVLDGKEHVALVKGD
IIPDEPILVRVHSECLTGDVFGSYRCDCGPQLHAALRQIEAEGRGVLLYMRQEGRGIGLM
NKLRAYKLQEQGYDTVEANEKLGFPADLRDYGIGAQILKDLGVTKMRLLTNNPRKIAGLK
GHGLEVVERVPLQMPAKKENEKYLRTKYEKLGHMLHF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacgattgaagcggcactggacgcgctgaaaaacggcgaagtgatcatcgtc
tgcgacgacgaagaccgggaaaatgagggcgattttgtcgcattggctgaaaaagcgacg
ccggatgtcgttaattttatgatcacccatggccgcgggcttgtgtgcgtgccgattacg
gaagagttggcggcgcggctcgggcttgagccgatggtcgcgcataacaccgacgctcat
gggacggcgtttaccgtcagcatcgactacaagacgacgacgaccggaatcagcgcctac
gagcgggcggcgaccattcaggcgctgctcgatccaaatgtgaaagcgagcgattttaaa
cggcctggccatatttttccattgattgccaaacaaggcggcgtcctgcggcgcgccggc
catacggaagcggcggtcgatttggcccgcctttgcggggcgaagccggctggcgtcatt
tgcgaaatcatgaaaaaggacggaacgatggcgcgcgttccggatttgcggcaaatcgcc
gaccaattcggattgaaaatgatcacgatcaaagatttgatcgcctatcggagccagcgg
gaaaaactagtgaagcgcgaggtcgacatttggctgccgactgagttcggcgagtttcgc
gccgtcggctacacgaacgtgcttgatggcaaggagcatgtggcgctcgtcaagggagac
attattcccgatgaaccgattcttgtgcgcgtccactccgagtgtttaaccggtgatgtg
ttcggttcgtatcggtgcgactgcggtccgcagctgcatgcggcgctgcggcaaatcgaa
gccgaggggcgtggggtgctgctttacatgcgtcaagaggggcgcggcatcggcctgatg
aacaaactgcgcgcctataagctgcaagagcaaggctacgatacggtcgaggcgaacgaa
aagctcggcttcccggccgatttgcgcgactacggcattggtgcgcaaattttaaaagac
cttggcgtcacgaaaatgcgtctgctcacgaacaatccgcgcaaaatcgccggcttgaaa
gggcacgggcttgaagttgtcgaacgggtgccgcttcaaatgccagcgaaaaaagaaaat
gaaaaatacttgcgcacgaaatatgaaaaactagggcatatgcttcatttttga

DBGET integrated database retrieval system