KEGG   Geobacillus sp. LC300: IB49_09535Help
Entry
IB49_09535        CDS       T04018                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00071  Fatty acid degradation
gel00072  Synthesis and degradation of ketone bodies
gel00280  Valine, leucine and isoleucine degradation
gel00310  Lysine degradation
gel00362  Benzoate degradation
gel00380  Tryptophan metabolism
gel00620  Pyruvate metabolism
gel00630  Glyoxylate and dicarboxylate metabolism
gel00640  Propanoate metabolism
gel00650  Butanoate metabolism
gel00900  Terpenoid backbone biosynthesis
gel01100  Metabolic pathways
gel01110  Biosynthesis of secondary metabolites
gel01120  Microbial metabolism in diverse environments
gel01130  Biosynthesis of antibiotics
gel01200  Carbon metabolism
gel01212  Fatty acid metabolism
gel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IB49_09535
   00630 Glyoxylate and dicarboxylate metabolism
    IB49_09535
   00640 Propanoate metabolism
    IB49_09535
   00650 Butanoate metabolism
    IB49_09535
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IB49_09535
   00072 Synthesis and degradation of ketone bodies
    IB49_09535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IB49_09535
   00310 Lysine degradation
    IB49_09535
   00380 Tryptophan metabolism
    IB49_09535
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IB49_09535
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IB49_09535
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IB49_09535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gel04147]
    IB49_09535
Enzymes [BR:gel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IB49_09535
Exosome [BR:gel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IB49_09535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2496 SpoVAD
Motif
Other DBs
NCBI-ProteinID: AKU26654
UniProt: A0A0K1KB87
Position
complement(1794297..1795475)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGVRTPFGKLGGALQALSAPELGGVAVKEALVRANVSAEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGEADIIVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTAKELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVSIPQRKGEPLVVERDEAPRKDTSLEALAKLKPVFDPEG
TITAGNAPGVNDGAAALVLMSQERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIDLFEVNEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLAHELKRRGGGLGIAAICSGGGQGDAILIEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacagtgattgtgagcggggtgcgcaccccgtttggaaaattgggcggcgcc
ttgcaagcgctgtcagcgcctgagctcggcggcgtcgccgtcaaagaggcgcttgtccgc
gccaacgtgagcgccgaacaagttgatcatgtcattttgggcaccgtcttgcaaggcgga
caagggcagcttccgtcgcggcaggcgatgcgccatgccggcattccgtggcacgtccgc
accgagacggtgaacaaagtatgcgcgtccggcatgcgcgccgtgacgcttgccgatcag
ctcatccgtttaggcgaggctgatatcatcgtcgccggcgggatggaatcgatgagcaac
gccccgtatgtgcttccgaaagcgcgctgggggctgcggatgggcgacagcacggtgaaa
gatttaatggtgtatgacggcctcacgtgcagcttcaccggcgttcatatgggcgtctac
ggcgggaatacggcgaaagagctcggcattacgagggaggcgcaagacgagtgggcgtac
cgcagccatatgcgcgccattgccgccatcgaagccgggcggctggcggaagaaatcgtg
ccggtttcgattccgcagcgcaaaggtgagccgcttgtcgttgaacgcgacgaggcgccg
cgcaaagatacgtcgcttgaagcgttggcgaaactgaaaccggtgtttgaccccgaaggc
acgatcacggccgggaacgccccaggcgtcaacgacggcgctgccgcgcttgtgttgatg
agccaggagcgcgccgcccgcgaggggctcgagccgctggcgacggtcgtcgcccacacg
gccatcgccgtcgaggcgaaagatttcccgaaaacgccggggcttgtcatcaacgaactg
ctccgcaaaacaggaaagaccgttgacgacattgacttgttcgaagtgaacgaagcgttt
gccgcggttgcgcttgccgccattcaaatcgccgggcttgatccggaaaaagtaaacgtc
aacggcggcgctgtcgccctcggtcatccgatcggcgcgagcggcgcgcgcatcatcttg
acgctcgcccatgagttgaagcgccgcggcggagggctgggcattgccgcgatttgcagc
ggcggcggtcaaggcgacgccatcttaatcgaagtataa

DBGET integrated database retrieval system