KEGG   Geobacter sp. M21: GM21_0304Help
Entry
GM21_0304         CDS       T00933                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gem  Geobacter sp. M21
Pathway
gem00030  Pentose phosphate pathway
gem01100  Metabolic pathways
gem01120  Microbial metabolism in diverse environments
gem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GM21_0304
Enzymes [BR:gem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     GM21_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACT16386
UniProt: C6DYB1
Position
complement(372564..374366)
Genome map
AA seq 600 aa AA seqDB search
MSGKPGYHGKILNIDLSTGKIETLPVPAEDFDKFVGGQGLGMKILWDRLKKPGVDPLSPD
NLLMFMPGPFSGLPVPSSSRTCVVTKSPITSPLKSDHTHPSTVTYSNMGGFFGPEVRFAG
YDGIVITGKARVLSYVVIDDDKVEIREAAKFKGMRTDAFDRAFLAELGDRRFKTVYIGPA
GENLVPYSSILHTAGRAAGRGGTGCVMGSKNLKAIAVRGSGQPTVADHKAFLAALENARR
ALNGSAFAKSWAEQGTARAIVGNSNAGTEAVRNYREGTFTEADKIGGDAARRDVWVKDIA
CYCCPLACKKSGMTKGKYGGVVHDGPEYETGVMLGSNLMISDMPGLLKAITTIDDLGLDQ
ISTGNVIGFLMEAYERGLINRSFLDGIDLKWGSVDATLAMIEKIAAKEGVGALAAEGVRA
LSWHIGKGSEKFAIQVKGLELAAHNIQANQPRGLSYVTASRGACHMSGDDIAMQNRRAMM
DSTGMCFFPTFEPTLEEPMLALLSAITGRKFDKAEFEKVGERIFNLEKLFNYREGFRRED
DRLPDRFFEDAFTVGPKKGAVLDREKFESMLTKYYQDRGWDPETTRPGKKKLKELGLESI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaaaccgggttaccacggcaagatattaaacatagacctttccaccgggaag
attgaaacgctgcccgtcccagccgaagacttcgacaagttcgtgggcgggcaggggctc
ggcatgaaaatactctgggaccggctgaagaagcctggcgtcgatccgctttctccggat
aacctgctcatgttcatgccagggccgttttccgggcttccggtcccgtcctcgtccagg
acctgcgtggtgacgaaatcccctatcacttcgcctttgaaatccgaccatacgcacccg
tccaccgtcacctactcgaacatgggagggtttttcgggcccgaagtccgctttgccggc
tatgacggcatcgtgatcaccggcaaggcgcgggtgctttcctatgtcgtaatcgacgac
gacaaggtggagattcgggaagccgccaagttcaaggggatgcgcaccgatgccttcgac
cgggcgttcctggcggagcttggggatcggcgattcaagacggtatatataggccctgcc
ggggagaatctggttccgtattccagcatcctgcataccgccgggcgggcagccggccgg
gggggtaccggttgcgtcatgggttccaagaatttgaaggccattgcggtgcgaggctcg
gggcagccgactgtcgccgaccataaagcgttccttgctgcgctggaaaacgcccgacgc
gccctcaacggttccgcgttcgccaagtcctgggcggagcaggggacggcgcgggccatc
gtcggcaacagcaatgccggaaccgaagcggtccggaattatcgcgaagggactttcact
gaggccgacaagataggcggcgatgcagcccggcgtgatgtctgggtaaaggacatcgcc
tgttactgttgcccgctcgcctgcaagaaaagcgggatgacgaagggaaaatacggtgga
gtcgtccacgacggacccgagtacgaaaccggcgtgatgctcggttcgaacctgatgatt
tccgatatgcccggactgctgaaggcgatcaccaccatcgacgatctcggcctggaccag
atctccaccggcaacgtcatcggctttctcatggaagcctacgagcgtggcttgatcaat
cggagttttctcgatggaatcgacctcaaatggggaagtgtcgatgcgacactggcgatg
atcgagaagatcgccgccaaggagggggttggcgccctggccgccgaaggggtgcgcgca
ctttcctggcacatcggcaaaggtagcgaaaagtttgccatccaagtgaaagggcttgag
ctggctgcccacaacatccaggcaaatcagccccgggggctttcctacgtcacggcatcg
cgtggggcctgccatatgagcggagacgacattgccatgcaaaacaggcgggccatgatg
gattcgaccggcatgtgctttttccccaccttcgaaccgacgctggaagaaccgatgctc
gccctgctcagtgccataaccggccggaaattcgacaaggctgaattcgaaaaagtgggc
gagaggatcttcaacctggaaaagctgttcaattaccgcgaagggttccgccgcgaagac
gaccgtctcccggaccgttttttcgaggacgccttcaccgtgggtccgaaaaagggagcg
gtgctcgaccgggaaaaattcgagagcatgctcaccaagtattaccaggatcgtggctgg
gacccggagaccacccggcccggaaagaagaagctgaaggaactggggctggagtccatt
tag

DBGET integrated database retrieval system