KEGG   Geobacter sp. M21: GM21_0389Help
Entry
GM21_0389         CDS       T00933                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
gem  Geobacter sp. M21
Pathway
gem00260  Glycine, serine and threonine metabolism
gem00630  Glyoxylate and dicarboxylate metabolism
gem00670  One carbon pool by folate
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GM21_0389
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM21_0389
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GM21_0389
Enzymes [BR:gem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     GM21_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ACT16470
UniProt: C6DYW9
Position
461183..462274
Genome map
AA seq 363 aa AA seqDB search
MEDLKATPLKAHHEGLKALMAPFGGWLMPIQYEGIIAEHRWCREKAALFDICHMGEFRFR
GDIQAGGLEDVFTFSVKGIPIGRSRYGFLLNQSGGVIDDLIVFRLAEDEVMIVVNAATAP
NDFKVIASRLKEPAQLVDISAQTGKLDLQGPLSREVLMEHLGSELGALPFFKFTRTRVLG
EDAIVSRTGYTGELGYEIFLPSGKTAELWELLLKDPRVAPAGLGARDLLRLEMGYSLYGN
DIDEKISPIAAGLTAFVNLDKDFVGKDALLREREAGPENVKVAFRVDSRRSPRHFYEILH
QGAPVGMVTSGAFSPMLSCGIGMGYVKPQAAALGTRLTIKHERVEMEAQVVDLPFYSGGS
LRA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagatctcaaggcgacaccgcttaaagcccaccacgaggggctcaaggcgctgatg
gctcccttcgggggatggctgatgccgatccagtacgaggggatcatcgccgaacacagg
tggtgccgagaaaaagcggcgcttttcgacatctgccacatgggcgagttccggttccgg
ggcgacatccaggccggcggtctcgaggacgtcttcaccttctcggtcaaggggatcccg
atcgggcgctcgcgctacgggttcctgctgaaccagtcggggggggtgatcgacgacctg
atcgtcttcaggctggcggaggacgaggtgatgatcgtggtaaacgccgcgaccgcgccc
aacgatttcaaggtgatcgcctcgcgcctgaaggagccggcgcaactggtcgacatctcg
gcgcagaccggaaagctggacctccaggggccgctctcccgcgaggtgctgatggaacat
ctcgggagcgaactcggcgcgcttcccttcttcaagttcaccaggacccgcgtcctcgga
gaggacgccatcgtgagccggaccggatacaccggcgaacttggttacgagatcttcctc
cccagcggcaagacggcggaactgtgggaactcctgctcaaggacccgagggtggccccc
gcaggattgggcgcccgcgacctgttgcggctggagatggggtactcgttgtacggcaac
gacatcgacgaaaagatctctccgatcgcagcggggctcaccgcattcgttaacctggac
aaggatttcgtcggcaaggatgcgctcctgagggagcgggaagcggggccggaaaacgtg
aaggtcgccttccgcgtcgactcccgccgctctccgcgccacttttacgaaatcctgcac
cagggggcgccggtggggatggtgaccagcggcgccttttcccccatgctttcctgcggc
atcgggatggggtacgtgaagcctcaagccgcggcgctggggaccaggctcaccatcaag
cacgagcgggtagagatggaggcccaggtggtcgaccttcccttctacagtggaggctcg
ttgagagcgtaa

DBGET integrated database retrieval system