KEGG   Geobacter sp. M21: GM21_1050Help
Entry
GM21_1050         CDS       T00933                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gem  Geobacter sp. M21
Pathway
gem00230  Purine metabolism
gem01100  Metabolic pathways
Module
gem_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GM21_1050
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GM21_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 Thymidylate_kin AAA_35
Motif
Other DBs
NCBI-ProteinID: ACT17111
UniProt: C6E2G5
Position
1232650..1233258
Genome map
AA seq 202 aa AA seqDB search
MKRDGVLYVISAPSGAGKTSLCKEIIDIFPNLRHSVSHTTRPPRTGEVHGRDYFFVGKEE
FNRMVEAGEFAEWAEVHGNLYGTSLSTLKESRTDGIDLILDIDCQGARQLKGRFEGGVYI
FVLPPNIEELRRRLDHRSSDSPEVIERRINNAAGEIKEARWYDYIIVNDRFSEAVEQLKS
VLIAERCRTTRLIQGLSVTFEI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagatggcgtactgtatgtgatatcggccccctcgggggcgggcaagacctcg
ctctgcaaggaaataattgacattttcccgaacctacggcattctgtcagccacacgacg
cgccctccccgtaccggagaggtgcacgggcgtgattatttttttgtgggcaaggaagaa
ttcaaccgcatggtggaggcgggagagttcgcggagtgggccgaggttcacggcaacctg
tacggcacctcgctttccaccttgaaggaatcccgcaccgacgggatcgacctgatcctt
gatatcgactgccagggcgcgcggcagctcaagggacgcttcgaagggggcgtctacatc
ttcgtgctccccccgaatatcgaggaactgcgccgccgcctcgaccaccgttcctccgac
tcaccggaggtgatcgaacgccgcatcaacaacgcggccggcgagatcaaggaagcgcgc
tggtacgactacatcatcgtgaacgaccggttcagcgaagctgtcgagcagcttaagagc
gtgctgatagccgagcgctgcagaaccacccgactcatccagggtctttccgtgaccttc
gagatctaa

DBGET integrated database retrieval system