KEGG   Geobacter sp. M21: GM21_1204Help
Entry
GM21_1204         CDS       T00933                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
gem  Geobacter sp. M21
Pathway
gem03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gem00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GM21_1204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gem02044]
    GM21_1204
Secretion system [BR:gem02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM21_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ACT17265
UniProt: C6E3K0
Position
1408963..1409622
Genome map
AA seq 219 aa AA seqDB search
MRLIDSFMPLIAYVVDFRAACRDTPRGYQEVKGDIAQLLLQAEKACGKEAVVSDEYDLAR
FAVCSWVDETLLGSDWRDRQLWQREQLQRLYYRTTEAGVELFDRLQALGARGEVREVYYL
CLALGFKGRYIGPGDEAKLEHLKQENLKLLLGTPAGIPSLEQGELFPGAHAPGRESSALK
APSGISPLTAMLIAAPIFLFVVLFLIYRYLLNGLVLPVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgatcgactctttcatgccgctcatagcctacgtggtcgacttccgcgccgct
tgccgcgacacgccccgcggttatcaggaggtgaagggggatatcgcgcagttgctgctg
caggcggaaaaggcatgcggcaaggaagcggtggtgagcgacgagtacgatctcgcccgc
ttcgcggtctgctcctgggtcgacgagacgctcctgggttccgactggagggacaggcag
ctctggcagcgggagcaactgcagcggctttattaccgcaccacagaggcgggggtggag
cttttcgaccggctgcaggcgctgggggcgcggggcgaggtgcgggaggtctattacctc
tgcctcgcccttggtttcaaggggcgttatatcgggccgggagacgaggccaagctggaa
catctgaaacaagagaacctgaagttgctgctcgggaccccggccggcatcccgtcgctg
gagcagggggagctcttcccgggtgcccatgcccccggccgcgaaagttcggccctgaag
gctccctctggaatttccccgctgaccgcgatgctgatcgcagcacccatcttcctgttc
gtggtgctgtttctcatttaccgctacctgctaaacggcctggtgcttccggtcctctag

DBGET integrated database retrieval system