KEGG   Geobacter sp. M21: GM21_2344
Entry
GM21_2344         CDS       T00933                                 
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
gem  Geobacter sp. M21
Pathway
gem02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gem00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GM21_2344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gem02044]
    GM21_2344
Secretion system [BR:gem02044]
 Type IV secretion system
  Trb secretion system protein
   GM21_2344
SSDB
Motif
Pfam: CagX Acyl-thio_N
Other DBs
NCBI-ProteinID: ACT18392
UniProt: C6DZ84
Position
complement(2725701..2726747)
AA seq 348 aa
MKATMLSVLLLFTVSCGSMAGPPPLKSEVVPAIPVSVPSTSPAQVVPQNVEAVKSMQDAA
PKGIRIKKQQAKKASVKKGPARRRMNERQVVEHRVKQSVQRPVNAMSVESKTLYSYVPDA
IYMIYAALNHVVDVQLQPGENLTGRIVAGDTHRWEVGTVTDGAGANITTHVLIKPKQAGI
ETNFLIVTDRHSYRLYAQANDDFFIPTVGWAYPEEEMAKSQQIRKEQQRLDGMVAAPAII
AANLNFKYKIKPDRKYPWTPIRAFDDGNKTYIQMSPEMKSSEAPVLFIKDGKNLNLVNYR
IKGDYYIVDRLFDEGELRSGKKDIVRIIRESPWFSSGKSYTDSGKMGR
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaaagccacgatgctgtccgtccttttgctcttcactgtgtcctgcgggagcatggcg
ggaccgccccccttgaaaagcgaggtggtgcccgccatccccgtctccgttccctctacc
tcccctgcccaggtggtgccgcagaacgtggaagcggtgaagtccatgcaggacgcagct
ccgaagggaatccggatcaagaaacagcaggcgaagaaggcgtcggttaagaaaggtccg
gccagaagaaggatgaacgagcggcaggtggttgagcaccgggtgaagcaatccgtgcag
cgcccggtgaacgccatgtcggttgagagcaaaactctctactcttatgtcccggacgcc
atctacatgatctacgccgcgctgaaccacgtggtcgacgtacagctgcagccgggcgaa
aatctgaccggtcgcatcgtggccggggacacccaccgctgggaggtggggaccgtgacc
gacggagccggagccaacatcaccacgcacgtcctgatcaagcccaagcaggcggggatc
gagaccaacttcctgatcgtcactgaccgccactcctaccgcctctacgcgcaggcgaac
gacgatttcttcatccccaccgtgggatgggcgtatcccgaagaggagatggccaagtca
cagcagatccgcaaggagcagcagcgcctggatggcatggtggccgccccggcgatcata
gcggcgaacctcaacttcaagtacaagatcaagccggacaggaagtacccttggaccccc
attcgcgccttcgacgacgggaacaaaacctatatccagatgtcccccgagatgaagagc
agcgaggccccagtccttttcatcaaggacgggaagaacctgaacctggtcaactaccgg
atcaagggggattactatatcgtggaccgcctgttcgacgagggcgagcttagaagcggc
aagaaggacatagtcaggatcatccgggagagcccctggttctcttctggaaagagctac
acggatagcggcaagatggggcgctag

DBGET integrated database retrieval system