KEGG   Geobacter sp. M21: GM21_2590Help
Entry
GM21_2590         CDS       T00933                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
gem  Geobacter sp. M21
Pathway
gem00051  Fructose and mannose metabolism
gem00520  Amino sugar and nucleotide sugar metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GM21_2590
   00520 Amino sugar and nucleotide sugar metabolism
    GM21_2590
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     GM21_2590
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     GM21_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF218 Cupin_1
Motif
Other DBs
NCBI-ProteinID: ACT18630
UniProt: C6E0K6
Position
complement(3021741..3023168)
Genome map
AA seq 475 aa AA seqDB search
MIIPVILSGGTGSRLWPLSRELYPKQLLPLVNQFTMLQNTVMRAEGISSNGCPIIVCNDD
HRFMVAEQVRELGVKSAAIILEPIGRNTAPAVALAALHALTLDENPLLLVLPADHVINDV
DCFQKVIEKVVPSAVAGKLVTFGIVPAGPETGYGYLKAGDRLTLNSDESDCFRVEQFVEK
PDHATAEQYLASGDYYWNSGMFMFTAHKYLEELGKYEPDMLAACKTVYAQAVMDNDFIRL
DRDTFSACPSDSIDYAVMEKTTDAVVSPLNAGWSDVGSWSALWEIGDQDDNGNVLKGDAF
LHDTKNCYISAEQRLIAAVGLQDCVIVETADAILVARKDRVQDVKAIVNQLKAHKRPEAS
VHRRVSRPWGAYQSVDNADRFQVKRITVNPGASLSLQMHHHRAEHWIVVKGTARVVKGDE
SILLSENQSTYIPLGLTHRLENPGVIPLELIEVQSGSYLGEDDIVRFEDVYGRSV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgattattccagtcatcctttctggcggcacaggtagccgactttggccgctctcacgg
gaactgtatccaaagcagcttctgccgttggttaatcagtttacgatgctacaaaacaca
gtcatgcgagcagaaggcatatcttctaatggctgcccaattattgtctgcaacgatgac
catcgctttatggttgccgaacaggtgcgggagttgggagtaaaatcagctgctataatc
ctggagccgattggcagaaacaccgcccctgcggtcgccttggcggctctgcatgcgttg
acacttgacgaaaatcctctattgctggtattgcctgcagatcatgtgatcaacgatgtc
gattgttttcaaaaggtgattgaaaaggtagtgccctctgctgttgccgggaaactggtc
acattcgggattgttcctgccggacccgaaaccggatatggatatttaaaagcgggtgat
aggttaaccttaaatagtgatgagtccgattgtttcagggtggagcagtttgttgagaag
ccagaccatgccactgccgagcagtatcttgcttcaggagattattactggaatagcgga
atgttcatgtttaccgcgcataaataccttgaggaactgggaaaatatgagccggatatg
cttgccgcatgtaaaactgtgtacgctcaagcagtcatggataatgactttatcaggttg
gaccgtgatactttttctgcttgtccgagtgactcaattgattacgctgtaatggaaaag
acaacggatgcggtggtgtcacctctcaatgcgggttggagtgatgtcggctcatggtct
gccttgtgggagattggcgatcaggatgataatggcaatgtgctcaaaggagatgctttt
ctgcacgatacgaaaaattgttatatttcggcggagcaacggcttatcgctgctgtgggg
cttcaagattgcgttattgtcgaaacagctgatgcgattctggttgcgcgaaaagacagg
gttcaggatgtaaaagccattgttaatcagctgaaagcacacaaaagacctgaagcttcg
gtgcatcgcagagtttcgcgaccgtggggtgcataccagtcagttgacaatgcagaccga
ttccaggtaaagcggatcacggttaaccctggtgctagcctttctctgcagatgcaccac
catcgtgctgaacattggattgtggtcaaaggtacggcccgtgttgtaaagggcgatgaa
tctatccttttgtcagaaaatcaatcaacctatattcctcttggattgacacatcgactt
gaaaacccgggagtcatccccctcgagttgattgaggttcaatccggtagttatttaggg
gaagatgacatcgttaggttcgaggatgtttacgggagatcggtctga

DBGET integrated database retrieval system