KEGG   Geobacter sp. M21: GM21_2794Help
Entry
GM21_2794         CDS       T00933                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gem  Geobacter sp. M21
Pathway
gem00071  Fatty acid degradation
gem00280  Valine, leucine and isoleucine degradation
gem00310  Lysine degradation
gem00362  Benzoate degradation
gem00380  Tryptophan metabolism
gem00620  Pyruvate metabolism
gem00630  Glyoxylate and dicarboxylate metabolism
gem00640  Propanoate metabolism
gem00650  Butanoate metabolism
gem00900  Terpenoid backbone biosynthesis
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01120  Microbial metabolism in diverse environments
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
gem01212  Fatty acid metabolism
gem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GM21_2794
   00630 Glyoxylate and dicarboxylate metabolism
    GM21_2794
   00640 Propanoate metabolism
    GM21_2794
   00650 Butanoate metabolism
    GM21_2794
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GM21_2794
   00072 Synthesis and degradation of ketone bodies
    GM21_2794
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GM21_2794
   00310 Lysine degradation
    GM21_2794
   00380 Tryptophan metabolism
    GM21_2794
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM21_2794
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GM21_2794
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GM21_2794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gem04147]
    GM21_2794
Enzymes [BR:gem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GM21_2794
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM21_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C AphA_like
Motif
Other DBs
NCBI-ProteinID: ACT18828
UniProt: C6E1I0
Position
complement(3245695..3246870)
Genome map
AA seq 391 aa AA seqDB search
MSDVYVIESLRTPLGSFGGSLSDVEAPRLAATVIAGIMDRTGLPAEAIDEVIVGQVLSGG
SGQAPARQAMRYAGLPDTVPALTINKVCGSGLKAIMLGAGSIKLGDAQVVLAGGMENMSL
APYALSKGRYGYRMGNGEMLDLLVHDGLTDPYSGKHMGVIAEQSAGENKLDRALQDNFAL
ASYQKAQAALKDGIFNDEIVPVVKKTRQGEVVVREDEEPHKVDFKKLPELRAAFQKDGTI
TAGNASTINDGAAIALLASGEAVAKYGLKPKARLVAYATNSVHPDQFAEAPVGAIAKVCA
KAGLNTDDIDLFEINEAFAAVPLIACQRLRLDPERVNVNGGAVALGHPLGASGARITATL
VRELHKRKLRYGLATLCIGGGEAVAVILERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtctatgtcatcgaatcactgcgtaccccgttgggctccttcggcggctcg
ctcagcgacgtagaggcgccgcgtctcgccgccaccgtcatcgccggcatcatggatcgc
accgggcttcccgctgaagccatcgacgaggtgatcgtcggccaggttctctcgggcggc
tcgggccaggctcccgcgcgtcaggccatgcgttatgcggggctccccgatacggtcccc
gcactcaccatcaacaaggtctgcggctccggccttaaagccatcatgctcggcgccggt
tccatcaagctcggcgatgcccaggtggtgctcgccggcggcatggagaacatgtccctt
gccccctacgcgctcagcaagggtcgctacggctaccgcatggggaacggcgagatgctg
gacctgctggtccacgacggcctgaccgacccctacagcggcaagcacatgggggtgata
gcggagcaaagcgccggagagaacaagctggaccgcgcactccaggacaacttcgcgctc
gcctcctatcagaaggctcaggcggccctgaaagacgggatcttcaacgacgagatcgtc
ccggtggtgaagaagacgcgccagggcgaggtggtcgtccgcgaggacgaggagccgcac
aaggtcgacttcaagaaactcccggaactccgcgcggcgttccaaaaggacggcaccatc
accgcgggtaacgcctccaccatcaacgacggcgccgccatagcgcttctggcgagcggc
gaggccgtggccaaatacgggctgaagcccaaagcccgcctggtcgcctacgccaccaac
agcgtccatcccgaccagttcgccgaagccccggtaggcgccatcgccaaggtctgcgcc
aaggcggggctcaacaccgacgacatcgacctcttcgagatcaacgaggcctttgccgcg
gtcccgcttatcgcctgccagaggctccgtctcgaccctgagcgcgtcaacgtaaacggc
ggcgcggtggcgctcggccacccgctgggtgcaagcggcgcgcgcatcaccgccaccttg
gtgcgggaacttcacaaacgcaaattacgctacggtctcgccacgctctgcatcggcggc
ggcgaggcggtcgcggtaatcctggaacgggtttag

DBGET integrated database retrieval system