KEGG   Geobacter sp. M21: GM21_2980
Entry
GM21_2980         CDS       T00933                                 

Definition
(GenBank) ribosome-binding factor A
  KO
K02834  ribosome-binding factor A
Organism
gem  Geobacter sp. M21
Brite
KEGG Orthology (KO) [BR:gem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gem03009]
    GM21_2980
Ribosome biogenesis [BR:gem03009]
 Prokaryotic type
  Other maturation factors
   GM21_2980
SSDB
Motif
Pfam: RBFA
Other DBs
NCBI-ProteinID: ACT19009
UniProt: C6E2P9
Position
complement(3461797..3462156)
AA seq 119 aa
MVKRSDKVGEEIHKIISELLIKGLKDPRIGFLTITGVKMTPDLRQATVYFTVHGSDEDKK
NSEAGLNSAKGYIRKEIGQALKMRFVPEVLFKYDTSLDYGQHIESILKEIGATDDGEQS
NT seq 360 nt   +upstreamnt  +downstreamnt
atggtaaagcgttcagacaaggttggggaggagatccacaagatcatctccgaactcctc
atcaaggggctcaaggacccgcgcatcgggtttctcaccatcacaggggtcaagatgacc
ccggacctcaggcaggcgacggtgtacttcaccgtgcatggcagcgacgaggacaaaaag
aacagcgaggcggggctcaactccgccaaaggttacatccgcaaggagatcgggcaggcg
ctgaagatgcgcttcgtccccgaggttctgttcaaatacgacacatccctggattacggc
cagcatatcgaatcgattctgaaggagataggggcaacggatgacggcgagcaaagctga

DBGET integrated database retrieval system