KEGG   Geobacter sp. M21: GM21_3220Help
Entry
GM21_3220         CDS       T00933                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
gem  Geobacter sp. M21
Pathway
gem02020  Two-component system
gem02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gem00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GM21_3220
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GM21_3220
Enzymes [BR:gem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GM21_3220
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GM21_3220
Two-component system [BR:gem02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GM21_3220
Bacterial motility proteins [BR:gem02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GM21_3220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACT19247
UniProt: C6E428
Position
3734030..3735121
Genome map
AA seq 363 aa AA seqDB search
MAIKVLIVDDSALIRSLLTEIINAEPDLQVVGTAPDPLAARQRIKELNPDVLTLDVEMPK
MDGLAFLEKLMRLRPMPVVMVSSLTEKSSAVTLKALEMGAFDFVTKPKIDIRSGIMEYAG
ELTEKIRCAYLSGRRINTARRVELRPAPAKLSADAVLPNRRDHFSSTEKVIAVGASTGGT
EALKAFLAALPPDCPGILVTQHMPETFTRTFAARLNGLCQLAVKEAEHGERVLPGHAYVA
PGNRHLMLARSGANYTVALGDGPAVSRHRPSVDVLFRSAANCAGANSLGIIMTGMGDDGA
AGMLEMHAAGARTIAQDEESCVVFGMPKEAIARGGVDEVVPLSEIAGRLIAWLASHGRRS
FRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaaggttctgatagtagacgattccgcactgatacgctcgctgctcaccgag
atcatcaacgccgagccggacctgcaggtggtcggcacagcgcccgaccccctggcggcg
cggcagcggatcaaggagcttaacccggacgtactcaccctggacgtggagatgccgaag
atggacgggctcgccttcctggaaaagctgatgcggctgcgccccatgccggtggtcatg
gtctcctcgctcaccgagaagagttcggcggtgacgctcaaggcgctggagatgggggcc
ttcgatttcgtgaccaagccgaagatcgacatccgcagcgggatcatggagtacgccggg
gagcttaccgagaagatccgctgcgcctacctctccggacgcaggatcaacacggcgcgg
cgagtggaactacgccctgcccctgcgaagctttccgccgacgcggtcctccccaaccgg
cgggaccacttctcctccaccgagaaggtgatcgcggtcggggcctcgaccggcggaacc
gaggcgctgaaggccttcctcgccgcccttccccccgactgcccggggatactggtgacc
cagcacatgccggagaccttcaccaggaccttcgcggcgcgcctgaacgggctttgccag
ctggcggtgaaggaggcggagcacggggagcgggtcctgccggggcacgcctacgtggcg
cccggcaaccgccacctgatgctggccagaagcggcgccaactacaccgtggcgctcggg
gacggccctgccgtctcccggcaccgcccctcggtggacgtgctctttcgctccgcggcc
aactgcgccggcgccaacagcctcgggatcatcatgaccggcatgggggacgacggcgcc
gccgggatgctggagatgcacgcggcgggagcgaggaccatcgcccaggacgaggagagc
tgcgtcgtcttcggcatgcccaaggaggcgatcgcccgcggcggcgtcgacgaggtggtg
ccgctttccgagatcgcggggcggctcatcgcctggcttgcctcgcacggcaggagaagt
ttcagggtgtag

DBGET integrated database retrieval system