KEGG   Geobacter sp. M21: GM21_3740
Entry
GM21_3740         CDS       T00933                                 

Definition
(GenBank) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
gem  Geobacter sp. M21
Pathway
gem00220  Arginine biosynthesis
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01210  2-Oxocarboxylic acid metabolism
gem01230  Biosynthesis of amino acids
Module
gem_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    GM21_3740
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     GM21_3740
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-ProteinID: ACT19759
UniProt: C6E6Y1
Position
4310557..4311435
AA seq 292 aa
MQQLIEKASTLMEALPYIRRFSGKTIVIKYGGHAMADEKLRKSFALDVILLKYIGINTVV
VHGGGPQINETLKRYGIVSEFVKGMRVTDKETMGVVEMVLTGQVNREVVGYINQNGGRAA
GLSGKDGDLLICEKLLQEVKSEDGSTETVDIGFVGDVVEVNPAILQALEKGGFIPVIAPV
GVGRAGESYNINADVVAGKVAAALNAEKLILLTDVSGVKSKEGELLSSIPLAEVPALIDN
GTVTGGMIPKVTCCTDALAAGVKKAHIVDGRIEHAILLEIFTNVGIGTEIQA
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagcaactcatagaaaaggcgagcacactcatggaggcgctcccttatatcagacgt
ttttccggcaagactatcgtcatcaagtatggcggccacgcaatggccgatgaaaagctc
aggaagtctttcgcactcgacgtcatcctgctcaaatacattggcatcaataccgtggta
gtgcacgggggcggtccgcagataaacgagacactgaagcgctacggaatagtgtcggag
ttcgtgaaggggatgcgcgtcaccgataaagagaccatgggcgtcgtggagatggtcctc
accgggcaggtcaaccgcgaggtggtgggatacatcaaccagaacggcggccgcgcggcc
gggctcagcggaaaagacggcgacctgctcatctgcgagaagctgctgcaggaagtaaag
agcgaagacggcagcaccgagacggtcgacatcggtttcgtcggcgacgtggtcgaggtg
aaccccgccatattacaggcattggaaaaggggggcttcataccggtcatagcgccggta
ggagtaggtcgagccggggagagctacaacatcaacgccgacgtcgtggccggcaaggtc
gcggccgccttgaacgccgaaaaactgatccttttgaccgacgtttccggggtgaagagc
aaggagggggaacttctttccagcatcccgcttgccgaggtccccgcactcatcgacaac
ggcaccgtcaccggggggatgatccccaaggtcacctgctgcaccgatgcgcttgccgcg
ggtgtcaagaaggcccacatcgtggacggccggatcgagcacgcgatcctgctggagatc
ttcaccaacgtcgggatcgggacggaaatacaggcttaa

DBGET integrated database retrieval system