KEGG   Geobacter sp. M21: GM21_3765Help
Entry
GM21_3765         CDS       T00933                                 

Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
gem  Geobacter sp. M21
Brite
KEGG Orthology (KO) [BR:gem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gem02000]
    GM21_3765
Transporters [BR:gem02000]
 Other transporters
  Others
   GM21_3765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate FeoB_C MMR_HSR1 FeoB_Cyto GTP_EFTU Dynamin_N AIG1 SRPRB AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACT19784
UniProt: C6E706
Position
complement(4339814..4342045)
Genome map
AA seq 743 aa AA seqDB search
MSTQLKSKKSLEEAEGSLDAEQQPALDRVITVAVAGNPNSGKSTLINAIAGTRLHVGNWA
GVTVEKKEAQLEYAGRKIKLVDLPGTYSLSPYTQEEIVARDYLVHERPDLIINVVDATNL
ERNLYLTVQLLELGIPMVMALNIYDEAQAKGYQIDVEGIEKMLGVAVVPTSATKKTGLDE
LFNSVLVAADDLAGHAPRKLKYGEDIEAAAEYVAEQLAQSHPAVAKRYPLRWLLLKLMEE
DSHVLDEVKLDRLEFMDQALRHLKRAHGEDIESIMADARYSLASGLTREVLQKPELRQTE
LTEKIDRIVLNRFLGIPIFLAAMWLLFKLTFDLSSPFGDWLGAMTEGPFKRWTSALLEPL
GAPDWTVSLINDGVIAGVGSVLVFVPVIFAMMFFITFLEGSGYMARAAFIMDRTMHSIGL
HGKSFIPMLLGFGCNVPGIYATRTLENPKDKVLTALLVPLMSCGARLPVYVLFVGIFFPN
NSSTVVWSLYILGIALAVLMGLVFKKTLFRGEAPMFIMELPPYRMPSFRSLCLHTWEKGK
HFLFKAGTYIFAVSVLVWFLLNLPWGVEHKRDSYLGRSGAAIAPIFEPVGFGTWEAASSL
ITGVIAKEIVVGTMGEIYAPKHDEEKAEEVPSLQEDLKEIVVSFGEACKAAVSTLFYLPS
AEEAEEDQSALKQAIGGAFTPLSSYAFMAFVLLYMPCVVVIAAMRQEFGSWKWAVVGLAY
QTVLAWGVALIVYQVGSLLGLGG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgcaattgaaaagcaagaagagtctggaggaggccgaaggaagccttgacgct
gagcagcagccggcgctggatcgggtcatcaccgtcgccgtcgcgggaaaccccaactcc
gggaagtccaccctcatcaacgccatcgccgggaccaggctccacgtgggcaattgggcc
ggtgtcacggtcgagaaaaaggaggcccagttggagtacgccggcaggaagatcaagctg
gtcgatcttcccggcacctactcgctctccccctacacacaagaggagatcgtggcgcgg
gattacctggtccacgagcgccccgacctgatcatcaacgtcgtcgacgcgaccaacctg
gagcgcaacctgtacctcaccgtgcagctcctggagttgggcatcccgatggtgatggcg
ctcaacatctacgacgaggcgcaggccaaagggtaccagatcgacgtcgaggggatcgaa
aagatgctcggtgtcgccgtcgtccccacctcggccaccaagaaaaccggcctcgatgaa
ctgttcaactcggtgctggtcgcggccgacgacctggcggggcacgccccgcggaagctc
aagtacggcgaagacatcgaggccgcagcggaatatgtggccgagcaactggcccagagc
catccggccgtcgcaaagcgttacccgctacgctggcttttgctgaaactgatggaggag
gacagccacgtccttgatgaagtgaagctcgaccggctcgagttcatggaccaggcgctg
cgccacctgaaaagggcacatggcgaggacatcgagtccatcatggcggacgcaaggtac
tcgctcgcctccggactcacgcgcgaggtgctgcaaaagccggagctgcggcagaccgaa
ctgacagagaagatcgaccgtatcgtgttgaaccgtttcctggggatccccatattcctc
gcggcgatgtggcttttgttcaaactcaccttcgatctttcctcccccttcggggactgg
ctgggagctatgacggaaggtcccttcaagcgctggacctctgctcttctcgagccgttg
ggcgcgccggactggaccgtctcgctgataaacgacggcgtgatcgctggggtggggtcg
gtgctggtgttcgtgccggtcatcttcgccatgatgttcttcatcaccttcctggaagga
agcggctacatggcgagggcggcgttcatcatggaccgtaccatgcattccatcggcctg
cacggcaagtccttcatcccgatgctcctgggctttggttgcaacgtgcccgggatctac
gccacgcgtacgcttgagaacccaaaggacaaggtactgaccgcactgctggtccccctg
atgtcctgcggcgcgcgtctgccggtgtacgtgctgttcgtcgggatcttctttcccaac
aactccagcaccgtcgtatggtctctctacatcctcgggatagctttggcggtgctgatg
gggctcgtcttcaagaagaccctgttccgcggggaggcccccatgttcatcatggaactc
cccccctacaggatgccctccttccgcagcctctgcctgcatacctgggagaagggaaag
catttccttttcaaggcaggcacctatatcttcgccgtttccgtgctggtttggttcctc
ctgaaccttccttggggggtggaacacaagagggactcctacctcggccggtccggcgcg
gcaatagccccgatcttcgaacctgtcggcttcggcacctgggaggcggcttcctcgctc
atcaccggggttatcgccaaggagatcgtcgtaggcaccatgggcgagatctacgctccc
aaacatgatgaggagaaggcggaagaggtcccgtcgctgcaggaagacctgaaggagatc
gttgtttctttcggtgaggcatgcaaggctgccgtttcgacgctgttctacctcccttcc
gccgaggaggccgaggaggatcagtcggccctcaagcaggcgatcggcggcgcattcact
ccgctatcgtcctacgccttcatggccttcgtgcttctgtacatgccttgcgtggtcgtc
atagcggcgatgcggcaggaattcggctcctggaaatgggccgttgtggggctagcctac
cagacggtcctcgcctggggcgtagcgctgatcgtttatcaggtgggaagcctgctggga
ctgggaggttga

DBGET integrated database retrieval system